Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G027914-GRMZM2G143640
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:3.3800681122059
Log2 mRNA fold difference:3.3447707517482
Log2 TE fold difference:-0.13695189661047
Sequences
Protein sequence

MDFHHGCHNSSIHAAAAPPARPWSKEENKMFESALVMWPEHTPERWALVAAQLHGRTPRE
AWEHYEALVADIALIERGGVDVPACWNDDNQVRGGCEGGTGNSRRAGADRAHREGRRPGK
PWSEEEHRLFLQGLEKYGRGDWRNISRFTVRTRTPAQVASHAQKYFNRQLNPASRNSKRK
SIHDITTP*

MDFHHSSSSSVHAHAAAARPWIKAEDFNPSSSVHAAGPPAVPAAARPWNRAEDKVFESAL
VAWPEHTPDRWALVAAQLPGRTPRDAWEHYEALVADVDLIERGAVDAPSCWDDDDGDHQV
RGAGADRARREARRPGIPWSEEEHRLFLQGLEKYGRGDWRNISRFSVRTRTPTQVASHAQ
KYFNRQFNPASRNSKRKSIHDITTP*

www.000webhost.com

Other information
Ka divergence:-0.392125KaKs divergence:-0.164973
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):567Length 2 (bp):618Length divergence:0.043
MFE 1 (kcal):-290MFE 2 (kcal):-308.71MFE divergence0.031