Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G027976-GRMZM2G170079
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272663
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.23598906658329
Log2 mRNA fold difference:-1.4681616027469
Log2 TE fold difference:1.2048546772626
Sequences
Protein sequence

MAQLPPRVPTAVHRWPEGGHHGAAAWADDFAEFAASRRGAHRRSLSDSVAFVEVAPAAGE
FDRLDDDQLMSMFPDEAAAGGGGGGSSAAGSENNGGSSDSYGDRRGGGGPAAGGTSTTTS
CNGFDGGEHNEAADAQATGQAAAAAAASTELIRDPKRVKRILANRQSAQRSRVRKLQYIS
ELERSVTTLQNEVSALSPRVAFLDQQRTILTVGNSHLKQRIAALAQDKIFKDAHQEALKK
EIERLRQVYEQQNLKMSAGAAASDHGPPPVRAEKELMS*

MAQQLPPRIPTEVHHWPEGGQHGAAAAWADDFAEFAAARRGAHRRSLSDSVAFVEVAPAD
GGAGEFDRLDDDQLLSMFPPDEAGGGGSSAAGSENGGSSDSDGDKRGARGGPAGGAPSTG
SGGGEQNGVVDAQAPAATGGQAAVVASTELIRDPKRVKRILANRQSAQRSRVRKLQYISE
LERSVTTLQNEVSVLSPRVAFLDQQRTILS

Other information
Ka divergence:0.496081KaKs divergence:0.350288
GC content 1 (%):68GC content 2 (%):72GC content divergence:0.029
Length 1 (bp):837Length 2 (bp):630Length divergence:-0.141
MFE 1 (kcal):-404.44MFE 2 (kcal):-325.91MFE divergence-0.108