Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028086-GRMZM2G099425
Species:maize
Duplication type:WGD
Function (paralog1):calcium-dependent protein kinase, isoform AK1
Function (paralog2):LOC100280693

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1825013222372
Log2 mRNA fold difference:-1.825604908031
Log2 TE fold difference:0.58205064694914
Sequences
Protein sequence

MGNCCVTPKAADDAGGGKKPKEPKQKKGKKPNPFSIEYNRSGQASAPKLVVLRDPTGRDI
AARYELGAELGRGEFGVTYLCTDRASGEALACKSISKKKLRTAVDLEDVRREVEIMRHLP
KHPNVVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAALVLRTIVEVVQMCH
KHGVMHRDLKPENFLFANKKESAALKAIDFGLSVFFTPGERFSEIVGSPYYMAPEVLKRN
YGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDNAKDLVR
GMLNPDPKRRLTAHQVLGHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKHALRVIAE
HLSVEEAADIKDMFEKMDLNKDQMLSFEELKLGLHKFGHQMPDADVQTLMEAADADGNGS
LNYGEFVTLFVHLRKIGNDEHLHKAFAYFDRNQSGYIEIDELRESLADDLGQNREEIINA
IIRDVDTDKDGKISYDEFATMMKAGTDWRKASRQYSRERFTSLSLKLQKDGSLQMTSTR*

MGNCCVTPNGAADAGGGKKPKEPKQKKGKKPNPFSIEYNRSTPASAPRLVVLREPTGRDI
AERYELGAELGRGEFGVTYLCTDRASGEALACKSISKKKLRTPVDVEDVRREVEIMRHLP
KHPNIVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAALVTRTIVEVVQMCH
KHGVMHRDLKPENFLFANKKESAALKAIDFGLSVFFTPGERFTEIVGSPYYMAPEVLKRN
YGPEVDVWSAGVILYILLCGVPPFWAESEQGVAQAIIRSVIDFKRDPWPRVSDNAKDLVR
GMLNPDPKRRLTAQQVLDHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKHALRVIAE
HLSVEEAADIKDMFEKMDLNKDQMLNFDELKLGLHKFGHQIPDADVQILMEAADADGNGS
LDYGEFVTLSVHLRKIGNDEHLHKAFAYFDRNQSGYIEIDELRESLADDLGQNHEEVINA
IIRDVDTDKDGKISYDEFAAMMKAGTDWRKASRQYSRERFTSLSLKLQKDGSLQMESTQ*

Other information
Ka divergence:-0.409371KaKs divergence:-0.142629
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1620Length 2 (bp):1620Length divergence:0
MFE 1 (kcal):-591.4MFE 2 (kcal):-607.9MFE divergence0.014