Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028234-GRMZM2G428179
Species:maize
Duplication type:WGD
Function (paralog1):RING-H2 finger protein ATL2K
Function (paralog2):RING-H2 finger protein ATL2K

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.3260398355548
Log2 mRNA fold difference:0.4654177963703
Log2 TE fold difference:-1.8087427533446
Sequences
Protein sequence

MSTTTTTMKASDPGSAWFGSGARAPAAAAGTGHNVRLITTAVAAFVSVLGLALFLHLYVC
HVRRRNRRRAAAIAAALPTTAAAPAPKGGLDPAAIAALPTTLYRNDAAEAGAGSDECTIC
LGAVQDGEVVRALPACGHVFHVPCVDTWLASSSSCPVCRAEVEPPPPTAVGSARFVQEKV
QDAVKQEAGSSTPDRGIGACASLIKMLSRERPAPRRPQGAYADAGDLDDLERQQYAVAVN
N*

MSTTTTKASDPGSAWFGSGARTRSAAGISHNARLVTTAVAAFVSVLGLALFLHLYVCHVR
RRNRRRAAAVLPTTTAAAAAAAAPKRGLDPAAVAALPTVLYRDAGGADDGAECTICLGAV
QEGELVRALPACGHVFHVPCVDTWFASSSSCPVCRAEVEPPPPPALSSSALFVQAEKVVQ
DAVKEEAGSSTPERGIGACASLMKMLSRERPAPRRPHADAGDLDDLERQQHSVAVNN*

Other information
Ka divergence:0.0391069KaKs divergence:0.0509421
GC content 1 (%):72GC content 2 (%):73GC content divergence:0.007
Length 1 (bp):726Length 2 (bp):714Length divergence:-0.008
MFE 1 (kcal):-407.9MFE 2 (kcal):-408.8MFE divergence0.001