Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028379-GRMZM2G031501
Species:maize
Duplication type:TD
Function (paralog1):p8MTCP1
Function (paralog2):hypothetical protein LOC100272713

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.61992286367134
Log2 mRNA fold difference:-0.15576339425884
Log2 TE fold difference:-0.47458713872757
Sequences
Protein sequence

LREPTRQIFLCRKTGPQTGTNGSRVETSSAFSLIKPNAQGPPCSISLSVVLSLSIRSPPH
PEPAVSLGFRRRRRHASPQLRSAPRPAPRAAPVRNPPQPARQAPPPAPVRDGGGSMFGGI
GSTIAQGMAFGTGSAMAHRAVDAVLGPRTIQHETVASEAAAAAPAPPVMNADACSIHSKA
FQDCLNNYGSEISKCQFYLDMLNECRRGGVSA*

MPRRSSGRSAPRPAPRAASLRNPPQPARQAPPPAPVRDGGGSMFGGIGSTIAQGMAFGTG
SAMAHRAVDSVLGPRTIQHETLATEAPAAAPAAPAMNADACSFHSKAFQDCLNNYGSEIS
KCQFYLDMLNECRRGGVSV*

Other information
Ka divergence:0.0640241KaKs divergence:0.222217
GC content 1 (%):58GC content 2 (%):57GC content divergence:-0.009
Length 1 (bp):639Length 2 (bp):420Length divergence:-0.207
MFE 1 (kcal):-220.04MFE 2 (kcal):-153.11MFE divergence-0.179