Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028393-GRMZM2G042789
Species:maize
Duplication type:TD
Function (paralog1):subtilisin-chymotrypsin inhibitor homolog1
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.8724823535845
Log2 mRNA fold difference:-1.9204889347488
Log2 TE fold difference:-0.98475941832324
Sequences
Protein sequence

MSSTECGGGGGGAKTSWPEVVGLSVEDAKKVILKDKPDADIVVLPVGSVVTADYRPNRVR
IFVDIVAQTPHIG*

MSASSAKPATGGKTSWPEVVGLSVEEAKKVILADKPNADIVVLPTTTQAVTSDFGFDRVR
VFVGTVAQTPHVG*

Other information
Ka divergence:0.211208KaKs divergence:0.202035
GC content 1 (%):67GC content 2 (%):66GC content divergence:-0.008
Length 1 (bp):222Length 2 (bp):222Length divergence:0
MFE 1 (kcal):-100.8MFE 2 (kcal):-99.7MFE divergence-0.005