Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028432-GRMZM2G101020
Species:maize
Duplication type:WGD
Function (paralog1):V-type proton ATPase 16 kDa proteolipid subunit Fragment (V-ATPase 16 kDa proteolipid subunit)(Vacuolar proton pump 16 kDa proteolipid subunit)
Function (paralog2):V-type proton ATPase 16 kDa proteolipid subunit Fragment (V-ATPase 16 kDa proteolipid subunit)(Vacuolar proton pump 16 kDa proteolipid subunit)

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.0096740855536049
Log2 mRNA fold difference:0.42298424387169
Log2 TE fold difference:-0.45182457717836
Sequences
Protein sequence

MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACG
LAGLAAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR
AD*

MSSAFSGDETAPFFGFLGASAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG
VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):59GC content divergence:0
Length 1 (bp):369Length 2 (bp):498Length divergence:0.149
MFE 1 (kcal):-148.3MFE 2 (kcal):-204.2MFE divergence0.159