Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028467-GRMZM2G144021
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):esterase/lipase/thioesterase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.0314534895041
Log2 mRNA fold difference:2.8479055540858
Log2 TE fold difference:-0.79253660682249
Sequences
Protein sequence

MGGVTSTIAARFAFFPPTPPSYTVVVADAATGRLAIPEISRALSRRRRRDGAGAGGSSSA
SSVAAAENEEGAEVVRLRTRRGNEIVGVYVRHARASATLLYSHGNAADLGQMYGLFVELS
RRLRVNLFGYDYSGYGRSTGKPTECNTYADIEAAYNCLKEKYSVADEDIILYGQSVGSGP
TIDLASRLPDLRAVVLHSPILSGVRVLYPVKRTFWFDIYKNIDKIGLVNCPVLVIHGTSD
DVVDCSHGKQLWEHCKVKYSPLWLNGGGHCNLELYPDYIKHLKQFVSSVSKKTSKPDQKE
IMAKDGTTSKEREEAYSEKPQPAAKCSQSQISRKSIDSRVGKSKTVDVPDKSRMSSDDID
KFRRRRCLVW*

MGGVTSTIAARFAFFPPTPPSYTVVVADAATGRLAIPEISRAPSRRRRRDGAGAGGSSSA
SSVVAAAEEEDGAEVVRLRTRRGNEIVGVYVRHARASATVLYSHGNAADLGQMYGLFVEL
SRRLRVNLFGYDYSGYGRSTGKPTECNTYADIEAAYNCLKEKYGVADEDIILYGQSVGSG
PTIDLASRLPDLRAVVLHSPILSGLRVIYPVKRTFWFDIYKNIDKIGLVNCPVLVIHGTS
DDVVDCSHGKQLWEHCKVKYSPLWLSGGGHCNLELYPDYIKHLKKFVSSVSKKASSKPDP
KETTTKDDTTSKETEEAYPEKPQEAKKCPQISRKSLDSRFGKSKTVDVPDKPRMSSDDID
KFRRSRCLVW*

Other information
Ka divergence:-0.300988KaKs divergence:-0.27431
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):1113Length 2 (bp):1113Length divergence:0
MFE 1 (kcal):-405.3MFE 2 (kcal):-423.36MFE divergence0.022