Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028570-GRMZM2G098679
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):solute carrier family 2, facilitated glucose transporter member 8

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.67023133971158
Log2 mRNA fold difference:0.78060029684365
Log2 TE fold difference:0.057285981280558
Sequences
Protein sequence

MASDGDHGGALQKPLLPKAARGGGWFRKGTSTAHPSGLSAAAAGTSSKAAALRPTHHVPA
LLCTLVVALGPIQFGFTTGYSSPAQDGVTRDLNLSISEFSAFGSLSNVGAMVGAIASGQM
AKYVGRRGSLMIAAVPNIMGWLAISLARDTSFLYMGRLLEGFGVGVISYVVPVYIAEISP
QNMRGALGVVNPISSSGMTLSLLTVAVVFYIKGNISHDSDLGNTLSMVSLIGVLACVTAY
SFGMGAIPWIIMAEILPVSINSVAGSFATLANWLTSFGITMTANLLLSWSAAGTFALYMM
VSAFTVVFVILWVPETKGKTLEEIQWFFQ*

MASDGDHGGALQKPLLPKAPRSGGWFRKGTSTARLGAAAAGTSSKAAALRPPHHVPALLC
TLVVALGTVQFGFTSGYSSPAQDGVTRDLDLSISEFSVFGSLSNVGAMVGAIASGQMAKY
VGRRGSLMIAAVPNVMGWLAISLARDTSFLYVGRLLEGFGVGVISYVVPVYVAEISPQNM
RGALGAVNPLSATFGVVFADVLGLFFPWRLLALIGTLPCLLLIPGLFFIPESPRWLARMN
MMDECEASLQVLRGVDADITVEANDIKIAVASANKSGAMSFQELNQKKYRTPLILGMGLL
VLQQLSGINGIIFYAGSIFKAAGLKNSNLDTCILGVIAVLATAVTTKILDRAGRRILLII
SSFGMTLSLLVVAVVFYIKDNISHDSDLGNTLSMVSLVGVLAYVTAYSFGMGAIPWIIMA
EILPVSIKSVAGSFATLANWLTSFGITMTANLLLSWSAAGTFAFYMMVSAFTLVFVILWV
PETKGRTLEEIQWSFQ*

Other information
Ka divergence:-0.291205KaKs divergence:-0.0588235
GC content 1 (%):57GC content 2 (%):54GC content divergence:-0.027
Length 1 (bp):990Length 2 (bp):1491Length divergence:0.202
MFE 1 (kcal):-413.77MFE 2 (kcal):-598.4MFE divergence0.182