Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028594-GRMZM2G070446
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193074
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.5630334339294
Log2 mRNA fold difference:-0.98790470717749
Log2 TE fold difference:0.4226894639556
Sequences
Protein sequence

MKIQCNACGAAEARVLCCADEAALCVACDEEVHAANKLAGKHQRVPLLTDAAAAAAAAAP
AVPKCDICQLVWCRSRGEGAYELYLDVANRLQGLMRLAQGANKQQPYPELLSLFEASGYF
FCLEDRALLCRDCDVAIHTVNSFVSVHQRFLLTGVQVGLDPADPVPPIAEKHVNAVGGSV
NQPVRHQPRRSPTVQFSVEGSASVPTKNVTNGDCSRQNFVPTARAEVVDWTMNNSTIRSV
ESPPKYISEESPTLLQSSQTTTVFSNQINGNSDGAYHLSFSGGNVTDSLPDWPVDEFFSN
SEYGPNFGFSENGSSKAKLESDILSGIYMKKGDTAKLGGAGGSPQCRLAEGSVAEELLGQ
VPGLITDEYMGRVPENSWTVPEVPSPPTASGLNWHGNLCFPAYDSTMFVPEITSLQNSQS
HFTVPSSFKRRRREY*

MRIQCNACGAAEARVLCCADEAALCVACDEEVHAANKLAGKHQRVQLLTDSATAAASPAP
AVPKCDICQEASGYFFCLEDRALLCRDCDVAIHTVNSFVSVHQRFLLTGVQVGLDPADPV
PPIAEKHVNASGGSVKQSVRHLPRRSPGVQFSVEGSASVPSKNVSNGDYSRQNSVPTARA
EVVDWTKNNTTIQSVESPPKYMSEESPTLLQSSQTTTVFSNQINGNSDGTYHLSFSSGNV
TDSLPDWPVDEFFSNSEYVPNLGFSEHGSSKGDNAKLESAGGSLQCRLAEGSIAEELLGQ
VPGLITDDYMSRVPENSWTVPEVPSPPTASGLNWHGNLCFPAYDSTMFVPEITSLQNSQN
QFTVPSSFKRRRREY*

Other information
Ka divergence:0.221771KaKs divergence:0.249347
GC content 1 (%):52GC content 2 (%):50GC content divergence:-0.02
Length 1 (bp):1308Length 2 (bp):1128Length divergence:-0.074
MFE 1 (kcal):-489.42MFE 2 (kcal):-400.51MFE divergence-0.1