Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028604-GRMZM2G018280
Species:maize
Duplication type:WGD
Function (paralog1):HT1 protein kinase
Function (paralog2):hypothetical protein LOC100381973 (LOC100381973), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLSCFRLPRPIGGGDVDQQAAAVSPRRGPSLPFAASPSTSGRGRSPWPPPEADDMEKKRW
DSMESWSMLLDTVLCEGSSRPDSSGRREEWMADLSQLFIGNKFAAGANSRIYRGIYKQRA
VAVKMVRIPERDEAQRAVLEEQFNSEVAFLSRLYHPNIVQFIAACKKPPVYCIITEYMSQ
GTLRMYLNKKDPHSLSPETILKLALDISRGMEYLHAQGVIHRDLKSQNLLLNDEMRVKVA
DFGTSCLETKCQATKGNKGTYRWMAPEMTKEKPYTRKVDVYSFGIVLWELTTCLLPFQGM
TPVQAAYAASEKNLRPPLSSSCPPVLNSLIKKCWSANPARRPEFSYIVSVLEKYDHCVKE
GMPTMMAHQELRLWRSFAKIFRMGCITNNLSRTVNA*

MLSCFRLPRPVGGGGGDADQQAAAVSPRRGPSLPFAASLFAASPSTSTSGRGRSAWPPEA
DGMEKKRWDSMESWSMLLDTVMGSGGEGSSRDSGRREEWMADLSQLFIGNKFASGANSRI
YRGIYKQRAVAVKMVRIPERDEARRAELEEQFNSEVAFLSRLYHPNIVQFIAACKKPPVY
CIITEYMSQGTLRMYLNKKDPYSLSAETILKLALDISRGMEYLHAQGVIHRDLKSQNLLL
NDEMRVKVADFGTSCLETKCQATKGNKGTYRWMAPEMTKEKPYTRKVDVYSFGIVLWELT
TCLLPFQGMTPVQAAYAASEKNLRPPLSSSCPPVLNNLIKKCWSANPARRPEFSYIVSVL
EKYDHCVKEGMPVTAHQELRLWRSFAKIFRTGCITNNLSIPVHA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):1191Length 2 (bp):1215Length divergence:0.01
MFE 1 (kcal):-572.45MFE 2 (kcal):-624.38MFE divergence0.043