Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028640-GRMZM2G096695
Species:maize
Duplication type:WGD
Function (paralog1):enzyme of the cupin superfamily (LOC100284006), mRNA
Function (paralog2):hypothetical protein LOC100191739

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.0672909002546
Log2 mRNA fold difference:9.4918140899883
Log2 TE fold difference:-7.4225908873627
Sequences
Protein sequence

MATEKLGIKVERNPPESRLSELGVRQWPTWGCEKSKFPWTYSAKETCYLLQGKVKVYPDG
HGEEFVEIAAGDLVVFPKGMSCTWDVAEAVDKHYNFE*

MTSPMVATPVQFHTTGRLSFCSFSFPSASGRRRFAAVRASAETMATEKLGIKVERNPPES
RLSELGVRQWPKWGCEKSKFPWTYSAKETCYLLQGKVKVYPEGHGEEFVEIGAGDLVVFP
KGMSCTWDVAEAVDKHYNFE*

Other information
Ka divergence:-0.331134KaKs divergence:-0.27044
GC content 1 (%):64GC content 2 (%):65GC content divergence:0.008
Length 1 (bp):294Length 2 (bp):423Length divergence:0.18
MFE 1 (kcal):-128.6MFE 2 (kcal):-191.2MFE divergence0.196