Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028721-GRMZM2G043782
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272410
Function (paralog2):presenilin

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.2723281338144
Log2 mRNA fold difference:2.3473725186431
Log2 TE fold difference:-1.628147961815
Sequences
Protein sequence

MDPAGASPAPAPAVEEPVSATSIFDTLGAEVLAVMSPVSICMALVVLLISLLSPPSSGSA
SSSPPPVTAATLVYLESPNDSPGQKLLGALLDAAVFVALVAAVTFVLVALYYFRCTGFLK
NYMRFSAFFVIFSMGGAIVAAVLRRLAVPLDAPTALLLLFNGAAVGVLSVFASAVPILVR
QGYMVALAVIVAAWLSRLPEWTTWIMLVALALYDLVAVLAPRGPLRMLVELASSRDDELP
ALVYESRPTVGPVTSSSSYASAMGSVEMQTMADSGQIGSSQYEQEEDASPAFVQMRDLVR
VRSSIGEMKRSRGSVLQMENLEREVPVISAELTANQGGSSQHAIIQIEHPDVEETSPLVS
APSTYNAALDEEHRQSSSSEPLDFEMFESTRGIKLGLGDFVFYSVLVGRAAMYDLMTVYA
CYLAIIAGLGCTLVLLSICRHALPALPISIMLGVTFYFLTRLLMEPFVVGASTNLVMF*

MDRAAASPPAVEEPVRATSVLDSLGAEVLAVMSPVSICMALVVLLISLLSPPSSGSAAGS
PPPVTAATLVYLESPNDSPGQKLLGALLDAAVFVALVAAVTFVLVALYYYRCTGFLKNYM
RFSAFFVIFSMGGAIVAAVLRRLGAPLDAATVLLLLFNGAAVGVLSVFASAVPILVRQGY
MVALAAIVAAWLSRLPEWTTWIMLVALALYDLVAVLAPRGPLRMLVELASSRDDELPALV
YESRPTVGPATSSSSYASVMGSVEMQTMSDSGQICGNRYDRVEQEEYASHASLEMRDLGR
GRSSVGEMNRPRGPVLQMENLEREVPATSAELTANQGGGSQHAIIQIEQPDEEETSPLVS
APSTNTAALDVEEHRQSSSSEPLDFEMFESTRGIKLGLGDFVFYSVLVGRAAMYDLMTVY
ACYLAIIAGLGCTLILLSICRHALPALPISIMLGVTFYFLTRLLMEPFVVGASTNLVMF*

Other information
Ka divergence:0.0424728KaKs divergence:0.10138
GC content 1 (%):57GC content 2 (%):59GC content divergence:0.017
Length 1 (bp):1437Length 2 (bp):1440Length divergence:0.001
MFE 1 (kcal):-518.81MFE 2 (kcal):-546.62MFE divergence0.026