Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028830-GRMZM2G159700
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):enzyme of the cupin superfamily

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.5808489424205
Log2 mRNA fold difference:2.0009063636453
Log2 TE fold difference:-0.36570394805619
Sequences
Protein sequence

MASGSNPDSMDTEPPGVLSIAVERNPPESRLQQLGVKSWPKWGCPPGKFPVKFDARQTCY
LLKGKVRAHIKGSSECVEFGAGDLVVFPKGLSCTWDVVAAVDKYYKFDSS*

MASGSKPDSMDTDPLGGGLSIAVERNPPESRLQQLGVRSWPKWGCPPGKFPVKFDARQTC
YLLKGKVRAHIKGSSECVEFGAGDLVVFPKGLSCTWDVAAAVDKYYKFDSS*

Other information
Ka divergence:0.00759406KaKs divergence:-0.279597
GC content 1 (%):67GC content 2 (%):67GC content divergence:0
Length 1 (bp):333Length 2 (bp):336Length divergence:0.004
MFE 1 (kcal):-149.6MFE 2 (kcal):-153.11MFE divergence0.012