Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G028926-GRMZM2G320506
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):LOC541988

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.001493411675711
Log2 mRNA fold difference:1.7944966298867
Log2 TE fold difference:-1.9325803027202
Sequences
Protein sequence

MGNTCVGPSITKNGFFQSVSTVLWKTSQDGDALPAAGSDANGPGRSQSTPPPALPKPASD
VHVAVQSKAPEPVKIAASHSEPAPKAAAPVAANASPSSSPNSSAEALPTRPRPKAPPVKR
VSSAGLLVGSVLKRRTENLKDKYSLGRRLGQGQFGTTYLCVERATGKEFACKSILKRKLV
TDDDVEDVRREIQIMHHLAGHPNVISIRGAYEDAVAVHLVMELCGGGELFDRIVQKGHYT
ERKAAELARVIVGVVEACHSMGVMHRDLKPENFLFADQKEEAALKTIDFGLSIFFHPGQI
FTDVVGSPYYVAPEVLKKKYGPEADVWSAGVIIYILLSGVPPFWAENEQGIFEEVLHGRL
DFESEPWPSVSEGAKDLVRRMLIRDPRKRLTAHEVLRHPWVQVGGLAPDKPLDSAVLSRM
KQFSAMNKLKKMALRVIAENLSEDEIAGLKEMFKMIDADNSGQITFEELKVGLKKVGANL
QESEIYALMQAADVDNNGTIDYGEFIAATLHLNKVEREDHLFAAFQYFDKDGSGYITADE
LQVACEEFGLGDVQLEDVIGEVDQDNDGRIDYNEFVAMMQKPPAGLPNKKAGLQNSFSIG
FREALRMA*

MGNTCVGPSITMNGFFQSVSTALWKTPQDSDALPAAAANGPGGASPGRSQSALPKPASDV
HHHIAVLSEAPEPVKIGAYHSEPAPAVQSEAPEPVKIAASHSEPAPMAAKPGAAAANASP
SPSPRPRPQVKRVSSAGLLVGSVLRRKTENLKDKYSLGRRLGQGQFGTTHLCVERGTGKE
LACKSILKRKLATDDDVEDVRREIQIMHHLAGHPSVVAIRGAYEDAVAVHLVMELCGGGE
LFDRIVRRGHYTERKAAELARVIVGVVEACHSMGVMHRDLKPENFLFADHSEEAALKTID
FGLSIFFRPGQIFTDVVGSPYYVAPEVLKKRYGPEADVWSAGVIIYILLCGVPPFWAENE
QGIFEEVLHGRLDFESEPWPSISDGAKDLVRRMLVRDPRKRLTAHEVLRHPWVQVGGVAP
DRPLDSAVLSRMKQFSAMNKLKKMALRVIAENLSEDEIAGLREMFKMIDADNSGQITFEE
LKVGLEKVGANLQESEIYALMQAADVDNNGTIDYGEFIAATLHLNKVEREDHLFAAFQYF
DKDGSGYITADELQVACEEFGLGDVQLEDLIGEVDQDNDGRIDYNEFVAMMQKPTVGVLP
KKADLQNSFSIGFREALRMA*

Other information
Ka divergence:0.295853KaKs divergence:-0.189824
GC content 1 (%):64GC content 2 (%):66GC content divergence:0.015
Length 1 (bp):1827Length 2 (bp):1863Length divergence:0.01
MFE 1 (kcal):-848.04MFE 2 (kcal):-886.7MFE divergence0.022