Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G029029-GRMZM2G092182
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273249
Function (paralog2):hypothetical protein LOC100194222

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.073704561131027
Log2 mRNA fold difference:-0.52063418006765
Log2 TE fold difference:0.46944285337078
Sequences
Protein sequence

MSSGRYMAYSPSPSTTPHSPRIAGLRAPSAAVAEQEKYLAELLAERQKLGPFVPVIPHSV
RLLNQEILRVSTLLENASLLNQSGLEHGSPLTTGGLYSNGAATDMNVWTSAFQPESSPAY
SWLGGSQGSSSGLIVKKTMKVDIPVDKYPTFNFVGRILGPRGNSLKRVEANTDCRVLIRG
RGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIIDARLMQAREILEDLLKPVDES
QDYFKKQQLRELAMLNGTLREEGMQRSGSASPFHNSLGMKRAKTRG*

MSSGRYMAYSPSPSTTPHSPRIHGLRTPSAAVAEQEKYLSELLAERHKLTPFIPVIPHSV
RLLNQEIFRVSTLLENASLLNQSGLEHGSPLTTGGLYSNGAATDMNGWPSAFQSESSPAY
SWLGGSQGSSSGLIVKKTMKVDIPVDKYPTYNFVGRILGPRGNSLKRVEANTDCRVLIRG
RGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVDIIDARLMQAREILQDLLKPVDES
QDFFKKQQLRELAMLNGTLREEGMQRFGSASPFHNSLGMKRAKTRG*

Other information
Ka divergence:0.208762KaKs divergence:0.250883
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):861Length 2 (bp):861Length divergence:0
MFE 1 (kcal):-288.9MFE 2 (kcal):-307.09MFE divergence0.031