Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G029048-GRMZM2G081582
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275863
Function (paralog2):phenylalanine ammonia-lyase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.6660910313969
Log2 mRNA fold difference:-1.8420366379865
Log2 TE fold difference:0.15567513329387
Sequences
Protein sequence

MECETGLVRSLNGEGLCMSAAAAAPRADALNWGKAAEDLSGSHLDEVKRMVVEFREPLVR
IQGASLSIGQVAAVAAGAGGEARVELDESARGRVKASSDWVMSSMMNGTDSYGVTTGFGA
TSHRRTKEGGALQRELIRFLNAGAFGTGADGHVLPAEATRAAMLVRINTLLQGYSGIRFE
ILEAIAKLLNANVTPCLPLRGTITASGDLVPLSYIAGLITGRQNSVAVGPDGRKVGAAEA
FRIAGIEHGFFELQPKEGLAMVNGTAVGSGLASTVLFEANVLAVMAEVISAVFCEVMTGK
PEFTDHLTHKLKHHPGQIEAAAIMEHVLEGSSYMKLAKKLGELDPLMKPKQDRYALRTSP
QWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRGKALHGGNFQGTPIGVSMDNTRLALA
AIGKLMFAQFSELVNDYYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLGNPVT
NHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMTSTFLIALCQAIDLRHLEENVKAAVK
NCVTQVAKKSLSLNARGGLHNARFCEKDLQTAIDREAVFAYADDPCSPNYPLMQKLRAVL
VEHALANGDAERAAETSIFAKVAEFEQQVRAALPKEVEAARAAVESGSPLVPNRIRECRS
YPLYRFVREDVGTEYLTGERTRSPGEELNKVLVAINQRKHIDPLLECLKEWNGAPLPLC*

MESEAGLLVRSSLNGEGLCMPAPRADPLNWGKAAEGLSGSHLDEVKRMVAEFRDPLVKIQ
GASLSVAQVAAVAVGAGGGEARVELDESARERVRASSDWVMGSMMNGTDSYGVTTGFGAT
SHRRTKEGGALQRELIRFLNAGAFGTGADGHVLPAEATRAAMLVRVNTLLQGYSGIRFEI
LEAIAKLLNANVTPCLPLRGTITASGDLVPLSYIAGLITGRQNSVAVDPDGRKVGAAEAF
KIAGIEHGFFELQPKEGLAMVNGTAVGSGLASTVLFEANVLAVLAEVISAVFCEVMTGKP
EFTDHLTHKLKHHPGQIEAAAVMEHILEGSSYMKLAKRLGELDPLMKPKQDRYALRTSPQ
WLGPQIEVIRFATKSIEREINSVNDNPLIDVSRGKALHGGNFQGTPIGVSMDNTRLALAA
IGKLMFAQFSELVNDYYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLGNPVTN
HVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTFLIALCQAIDLRHLEENVKAAVKN
CVTQVAKKSLSLNARGGLHNARFCEKDLQTAIDREAVFAYADDPCSPNYALMQKLRAVLV
EHALANGDAERDVDTSIFAKVAEFEQQVRAALPKEVEAARAAVENGSPLVPNRIKECRSY
PLYRFVREEVGTKYLTGEKTRSPGEELNKVLVAINQRKHIDPLLECLKEWNGEPLPLC*

Other information
Ka divergence:0.224083KaKs divergence:0.542354
GC content 1 (%):68GC content 2 (%):67GC content divergence:-0.007
Length 1 (bp):2160Length 2 (bp):2157Length divergence:-0.001
MFE 1 (kcal):-1063.8MFE 2 (kcal):-1029.1MFE divergence-0.017