Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G029082-GRMZM2G457003
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383525
Function (paralog2):hypothetical protein LOC100383401

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.11604193060401
Log2 mRNA fold difference:2.2049993943429
Log2 TE fold difference:-1.9964634896062
Sequences
Protein sequence

MDRRSWLWRRKSTDKSPAETETSASSASERITDEQDTAKSSPNSTQSPEVTSKELEDGDN
VKVKVLSERLSSVVLDIRAKDDLVKQHSKVAEEAVLGWEKAETEIASLKAQLNAAAAKNS
ALEDRLVHLDGALKECVRQLRRAKDEQDQTVQGALAQQARQWESHKADLELRVVELTARL
EAKSERSVAAADCDTGSRLAALEKENSALRTQLLAKTEELELRTIEKELNRRAAETASKQ
QLEGIKKVAKLQVECRRLQAAAQRRPSVNVELRRSPSSACAESVTDCQSDCSDSWASVLV
AELDQFRIDRSGASSRAASLATADIGVMDDFLEMEKLASASKGDAVEDASGQVLRLEEKV
KKLAAEKAEREKALHEAQRELRTSRQRVMVAEERSAELQRQLNLANGEKHAMGAEVKAAE
AKRGELEGLLELARAEIAGLLDKGRILEERLESEKALTLELAAKYQDMEALRAEKRELSA
QLETSRSEAKKLGDKIALMERKLEVEKALSIRLATKCHGIDALEAKKKGVELELETAREE
IASLQNKASSLELRRVEEEKASSAALALRCQELDDLRSQLESSNSRIVELNEKVKTLEDV
VEEQRPVTVELESQLRSRRAEISSLKEDISLLQKKLESQKNLSSAYISALGASETEKKEL
ASRFELGEKEAEELRGKMSLLEEQIRKEKARSSEFAVKCQKMEEQISCRSLLGHQPVKSS
AAIKDLQLRKETELAKAAEKLADCQKTIASLSSQLKSLADFDEFPPETETSGADSDDAWD
SDLKLLQPASYPTQIGCLAVT*

MDRRSWLWRRKSTDKSPGETETSASEKITDEQTIISYSYQPSIIIPCPVHVLGQVTNASL
RLSATVTIRQNDTYTVSGKRKSKSLFSMFLSETVQPVFKIGNEIDDSTMGRGRGRQCDCP
GGFHTRSAVSNGNVAQSDQDSAKSSPNSTRSPEITSKELEDDNDVKVKVLSERLSSVVLD
VRAKDDLVKQHSKVAEEAVLGWEKAEKEISSLKAQLSAATAKNSALEDRLVHLDGALKEC
VRQLRRAKDEQDQTVQDALARQARQWESHKADLELRIVELTARLEAKSERSVVGATDGDT
RSSRLAALEKENSALKLQLLAKTEELELRTIEKELNRRAAETASKQQLEGIRKVAKLQAE
CRRLQAAAQRRASSVNVELRRSPSSACVESLTDCQSDCSDSWASALVTELDQFKKDKSGA
STRTASLVAADIDVMDDFLEMEKLASANGSSKGDAVEDASGQVEKALHEAQRELRTCRRR
VMVAEERSAELQRQLNHANGDKHAMEAEAEAAEAKGRELEGKLELARADIAGLLDKGRIL
EERLESEKALTLELAAKYQDMETLEAEKRELNAQLETSRSEAKKLSDKIALMERKLEVEK
ALSIRLATKCHGVDALEAKKKGVELELESAREEIASLRNKASSLELQVMEEKASSAGLAM
RCQELEELRSQLVSSNSRIVELNEKVKTLEDVIEKQRPVTAELESQLQSRHDEISSLKED
ISLLQKKLESQKNLSSAYISALGASETEKKELATRFELGEKEAEELRGKTSLLEEQIHEE
RARSSEFAVKCRKMEEQFSRRSLLGHQPVKSSAIKDIQIRKETELAKAAGKLADCQKTIA
SLSSQLKSLADFDEFLPETETSGADSADAWDGDLKLLHPASYPTQIGCLAVT*

Other information
Ka divergence:0.0387735KaKs divergence:0.0673022
GC content 1 (%):60GC content 2 (%):58GC content divergence:-0.017
Length 1 (bp):2406Length 2 (bp):2679Length divergence:0.054
MFE 1 (kcal):-1033.52MFE 2 (kcal):-1117.39MFE divergence0.039