Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G029113-GRMZM2G101179
Species:maize
Duplication type:WGD
Function (paralog1):nucleolar protein,Nop52 containing protein
Function (paralog2):hypothetical protein LOC100382218

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.2012875742775
Log2 mRNA fold difference:-0.64338270710061
Log2 TE fold difference:-0.55155898032372
Sequences
Protein sequence

MAAADASAETAAIARRLASCNTGTRERALRYLLSDFLPASAPRLSATDLLKLWKGIFFCF
WHADKPLYQSSVATRLASAVSAPPSPTDGTAFLAAYLTTLRREWAHIDVHRLDKFYLLNR
RFLHHAFLLLRANSFAPDVTSQVVSVLSDKALLPEADNVAAATSRGLGYHVAEAFLDELL
PVLPVSLETMDTLLAPFFTVLEKSTDRVMVSKVKAGVFERLLDSGSRLLEMVKKGEEVEK
GDAEEKLGKVGLLFGFSKRFLDIGAMAETVQSNRKVVFGLRDAFVKIEKGLQLSGLEIPA
PKFEATEVPVPPNVGKGKAQKKKKAKKAALAEGEMEEDNDLKREKKIKKEKKEKKRRKVE
VVDEGDVTEKSTNAPGADQQMGDGTDGITFDAALKSNLQKQFEMVAAEAGMAEGGSSSSD
SPVTPVTGKVATKRKRSKSADKLSEASAGDGGSEGNLLAQDGEKSGKKVRFSMKNNLVWR
PHNPLPPQCLRLPPSATPRGSALKKGVQPGPITPTPLKKAKPKAKSAKKVLKKPPSSAVK
RLRKLQSFSA*

MAAAAAAAAAADVPAEAAAIARRLASCNTGTRERAVRYLLSDFLPASARRLSATDLIKLW
KGLFFCFWHADKPLYQSSVATRLASAVSAPPSPTDGAAFLAAYLTTLRREWAHIDVHRLD
KFYLLNRRFLHHAFLLLSANSFAPVVTSQVVSVLSDKALLPEADSAAAGTSRGLGYHVAE
AFLDELLPVLPVTLETVDALLAPFFIVLAKSTDRVMVSKVKTCVFERLLESGSRLLEMVK
KGEEVDKGSAEEKLGKFGLLFGFSKRFLDIGANAATVQWNRKVLFGLRDAFVKIEKALQL
SGLEIPVPQFEAAELSVQPNAGDEKAQKKKKTKNVALAEGEMGDAKDLKREKKVKKDKKV
KKEKKKKRKVEVVDEGNTTDKSTDAPVDDQQIGDGADGITFDETLKSNLQKQFEMAAAEA
GMVKGGSSSSASPVTPVSGKVATKRKRSKSADKLSEASDGGDGSEGNLLAQDGEKSGKKV
RFSMKNNLVWKPHNPLPPQCLRLPPSATPRGSALKKGVKPGPITPTPLRKAKPKAKSAKK
VLKKQPSSAVKRLRKLQSFSA*

Other information
Ka divergence:0.113294KaKs divergence:0.126912
GC content 1 (%):56GC content 2 (%):57GC content divergence:0.009
Length 1 (bp):1653Length 2 (bp):1686Length divergence:0.01
MFE 1 (kcal):-646.05MFE 2 (kcal):-658MFE divergence0.009