Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G029186-GRMZM2G092085
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1990069965973
Log2 mRNA fold difference:-0.31390498550254
Log2 TE fold difference:-0.8722154898557
Sequences
Protein sequence

MASPSGNPNPNPNTPFEIGKLFRPPNPMTTATPNPIFPGVAGGPTGSPPPSGPYSYPPVT
PPFHRGPYIHYQQDPHAMARPVVSFPMPNPNLNPNPNPNANPNAASPGPNPGARLMQLLG
NSGPTQLETAVSMPPPTSEFAQLQQLPAMPSAPPARMLSSTSSKVPRGRLLGTGERAVHD
VDSRLPGEAQPPQLEVTPITKYTSDPGLVLGRQIAVNRTYIVYGLKLGNIRVLNINTALR
ALLRGHTQRVTDMAFFAEDVHRLASASIDGRIYVWRIDEGPDEENKPQITGKIEIAIQIV
GEAEAYHPRICWHSHKQEILFVGIGNCVLRIDTTKVGRGKDFTVEDPVKCHLEKLVDGVR
LVGKHDGDVTDLSISQWMSTRLASGSKDGSVKIWDDRKQVPLSIFKPHDGQAVYSVAFLT
APERPNHINLITAGLLNREVKIWASTNEDGWLLPSDSETWKCTQTLELVSSLEPRVEEAF
FNQVAVLPQASLILLANAKKNAIYAVHVEYGPDPASTRLDYIADFTVAMPILSLTGTHDS
QPDSEQVVQVYCVQTMAIQQYGLELPLCLPPTADSTGFGRDPAISRVYEAPLEMAGTESS
TGTSFTDSYSVSSLSKPSTVDQSAELDLKPSAPPLAYSEGDGSVPLPSAPPAPKMEAPGS
GPAPGGRGIDQSAFDYTTNRNVERDVLKRQDTPMPIRKDILGKDEPRDGHSDVPMLPNPR
LMFQVGGNATHLVTPSEIISGTLSSSENNDASKSDGGKSQDVSSRSSQVPEVEPKHIDES
KQDQNLGLEAVKETQIVCENMEKTRSSLDQTVEMISERSVTTDKYSVEESQSSSDRPTSD
QTGISENVLKKFVEMPEKIDYSSASREQSSSFTKEEKVLHPQTSGQPSPPVSAFNSTESH
EPLSSTYLPITVSSYPEVGATQGMLQQLMGRQEDMEKQLSTVVPASIAKEGKRLETSLGR
TVEKSIKANIDAFWARLQEENTKREKADRDRMQQFVTLITSSINKDLPSNLEKSLKKEIS
SLGPVVARAITPIIEKCLTSAVSDSVQKGLGDKLFNQLEKSITGKLEATLARQIQIQFHT
SGKQALQDALRTSFESLLVPAFEQACKTMFEQIDGAFQKGMSEHSTAIQHQVESSHSPLA
LTLKEIINSASSITQSFSSELLDGNRKLLALVTSGNAMAHNTSALQPINGPMGGSQEVEA
PLDPMKELGRLISERKFDEAFTMALQRSDVSIVSWLCSQVSSLHQIDHLRCTLVLHIRTT
LFWPCDAYTPLVQVDLRALCAMVPVPLNQGVLLALLQQLAIDIHNETSRKVQWMTDVAMA
INPADQMIAVHVRPIFEQVYNQLAHQRTLPTMTAADGTSIRVIMHVINSVLLSYK*

MAFFAEDVHRLASASVDGRIFVWRIDEGPDEENKPQITGKIEIAIQIVGEAEAYHPRICW
HSHKQEILFVGIGNCVLRIDTTKVGRGKDFTVEGPVKCHLEKLIDGVRLVGKHDGGVTDL
SISQWMSTRLASGSKDGTVKIWDDRKQVPLSIFKPHDGQAVYSVAFLTAPERPNHINLIT
AGPVNREVKIWASTNEDGWLLPSDSETWKCTQTLELVSSLEPRVEEAFFNQVAVLHQASL
ILLANAKKNSIYAVHVEYGPDPASTRLDYIADFTVAMPILSLTGTHESQPDGEQVVQVYC
VQTMAIQQYGLELSLCSPPTADSTGFGRDPAISRVYEAALEMAGTEPSIGTSCTDSYSVT
ALSKQPNVDQSAELDLKPSAPPLAYSEGDSSMPLPFTALAPKIEVPGSGPAPGTRDIEQS
AFNYTNTTNRNMERDALKRQDTPMPIRKDILGKDEPRDGQSNVPMLPNPHMVFQVGGNAT
RLVTPSEIISGTLSSAENNDVSESGGENRDVSSGSSWVAEVEPKHIDESKPDQNLGLEAV
KETQIVCENMAKTSMEQTVEMITKRSVTTDKHSVEESQSSSDRPASDQTCGTDENVLKKF
VEMPEKIDYSASREQPSLFTKEKVLHPQTSGQPSPPVSAFNSTEPHEPLSSTYLPVSSFP
EDAATQGMLQQKLLNILVQHCSLQLAATAGILYIF*

Other information
Ka divergence:0.311456KaKs divergence:0.259363
GC content 1 (%):48GC content 2 (%):43GC content divergence:-0.055
Length 1 (bp):4128Length 2 (bp):2088Length divergence:-0.328
MFE 1 (kcal):-1334.54MFE 2 (kcal):-633.42MFE divergence-0.356