Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G029307-GRMZM2G142825
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273625
Function (paralog2):hypothetical protein LOC100304273

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.99038175605281
Log2 mRNA fold difference:-0.2959550211078
Log2 TE fold difference:-0.69439171239948
Sequences
Protein sequence

MSESELAVIKPEALKTYIWLQCFDGSIQQVEEEVAMFCPMICREIMKNGTGSSKNHAIVL
PERVNPASLSLILDYCRFHQVPGRSNKERKSFDEKFVRIDTEKLCKLASAALGLQLRPLV
DLTCGALARIIGGKTPDEVRDIFHLPDDLTEEEKLEPLKNLNDDPTIRLLNRLYAKKRKE
LQERQKLKDVQTQEEQKDERSLDELLCFINGDGDSRGGKASKSKKKNKRRKDQAKNPTKA
NSEPVNKEGASCVVPCKADNGNISRHPCQSQNLQDTEYPFDNADLDDGLDPAMREEIDRE
VADFEMKLKLAWTERMSLEQDQQMESHVDTRW*

MSENELAVIKPEALKTYIWLQCFDGSIQQVEEEVAMFCPMICLEIVKNGTGSSKNHAIVL
PERVSPASLSLILNYCRFHQVPGRSNKERKSFDEKFVRIDTEKLCKLASAALGLQLRPLV
DLTCGALARIIGGKTPDEVRDIFHLPDDLTEEEKLEPLKNVNDDPTIRLLNRLYAKKRKE
LQERQKLKDVQTQEQKDERSLDELLCFINGHGDSRGGKASKNKKRNKRRKDQVKNPTKAD
SEPVNKEGASCVVPCKEDSNNLSRHPCQSPNLQDDVEYPFDNADLDDGLDPAMREELDRE
VAEFEMKLKLAWSERMVLGQDQPMESDVDTR*

www.000webhost.com

Other information
Ka divergence:0.560085KaKs divergence:0.457889
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):999Length 2 (bp):996Length divergence:-0.002
MFE 1 (kcal):-287.6MFE 2 (kcal):-274.92MFE divergence-0.023