Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G029370-GRMZM2G161102
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191443
Function (paralog2):hypothetical protein LOC100192544

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.11591447920782
Log2 mRNA fold difference:-0.24073749641881
Log2 TE fold difference:0.34245003056918
Sequences
Protein sequence

MAASARDSADAAERVVDDHDGWASDAEMDVEMDVVEGDADRRDGGADGDDEYLLLTRIRD
TSAAEARAGKDIQGIPWERIHIARQDYRKARLEQYKNYENFPQSGELMDKLCKQVEKSSK
YYEFQHNTRSVKPSILHFQLRNLLWATSKHDVYFMSNSTVSHWSSLSHKLSEVLDFSGHV
APAEKYPGSLLEGFSGVQVSTLAVNEGLVVAGGFQGELIGKDVEGCSVKFCMRTTLSDNA
ITNAIDIHRSISGSLHITVSNNDCGVREYDMERYQLVNHYRYNWPVNHTSVSPDKKLLAV
VGDDRDALLVDSRNGKVTSTLVGHLDYSFATAWHPDSRTFATGNQDKTCRIWDTRNLSTS
LAVLRGNIGAIRCIRYSSDGRFLVFSEPADFVHVYSVAADYKKRQEIDFFGEVSGITLSP
DDESLFIGVCDRVYASLLQYRMIRGFDYLDSYV*

MAASARDSADAAERVVDDHDGWASDGEMGMEMDVEGEFHDRDADRRDGGMDGDDEYLLLT
RIRDTSAAEARAGKDIQGIPWERIHIARQDYRKARLEQYKNYENFPQSGELMDKLCKQVE
KSSKYYEFQHNTRSVKPSILHFQLRNLLWATSRHDVYFMSNSTVTHWSSLSHKLSEVLDF
SGHIAPVEKHPGSLLEGFSGVQVSTLAVNEGLLVAGGFQGELIGKDLEGCNIKFCARTTL
SDNAITNAIDIHRSTSGSLRITVSNNDCGVREYDMERFQLLNHYRYNWPVNHTSVSPDKK
LLAVVGDDRDALLVDSRNGKVTSTLVGHLDYSFATAWHPDSRTFATGNQDKTCRIWDTRN
LSTSLAVLRGNIGAIRCIRYSSDGRFLVFSEPADFVHVYSVAADYKKRQEIDFFGEVSGI
TLSPDDESLFVGVCDRVYASLLQYRMIHAFDYLDSYV*

Other information
Ka divergence:-0.149789KaKs divergence:0.0348406
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1362Length 2 (bp):1374Length divergence:0.004
MFE 1 (kcal):-457.96MFE 2 (kcal):-470.14MFE divergence0.013