Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G029396-GRMZM2G108225
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191601
Function (paralog2):squalene synthase1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.32618503459751
Log2 mRNA fold difference:-0.24675268926784
Log2 TE fold difference:-0.076610677343141
Sequences
Protein sequence

MGALSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELRN
AVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHVYNRDWHYSCGTNHYKVLMDKFHL
VSTAFLELGQGYQKAIEEITRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGYGLSRLF
YAAGTEDLAPDSLSNSMGLFLQKTNIIRDYLEDINEIPKSRMFWPREIWSKYADKLEDFK
YEENTEKAVQCLNDIVTNALIHAEECLQYMSALKNHAIFHFCAIPQIMAIGTCALCYNNV
HVFRGVVKMRRGLTARIIDETNSMSDVYTAFYEFSSLIESKIDDNDPNAALTRRHVNSIK
QTCKSSGLVKRRGYHLDTSPYRPMLIMIVLLLVAILFGALYTK*

MGALSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELRN
AVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHIYNRDWHYSCGTNHYKMLMDKFRH
VSTAFLELGEGYQKAIEEVTRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGYGLSRLF
YAAGTEDLALDSLSNSMGLFLQKTNIIRDYLEDINEIPKSRMFWPREIWSKYADKLEDFK
YEENSKKAVQCLNNMVTDALIHAEECLQYMSALKDPAIFRFCAIPQIMAIGTCALCYNNV
HVFRGVVKMRRGLTARIIDETNSMTDVYTAFYEFSSLIESKIDDSDPNAALTQRRVDSIK
QTCKSSGLVKQRGYHLEKSPYRPMLIMIVLLLVAILFGVMF*

www.000webhost.com

Other information
Ka divergence:0.183576KaKs divergence:0.37396
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1212Length 2 (bp):1206Length divergence:-0.002
MFE 1 (kcal):-388.18MFE 2 (kcal):-392.88MFE divergence0.006