Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G029527-GRMZM2G076389
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279383
Function (paralog2):hypothetical protein LOC100382098

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.9415338168502
Log2 mRNA fold difference:-0.7043799957537
Log2 TE fold difference:-1.2265924238739
Sequences
Protein sequence

MDGSAAELEAAERVVMRWDSSSAGAGADEPMLFDGGGDRAEADRFLRAVDDLRRLAPPSP
AAVGSPRRLSSSSVAASGAVQVAMARLEDEFRHVLSTRALDLEIEALADLSSLSINSDRT
NSASSADLPAADEDDSVSSSIGRRSTAYRSLRSIREIDLLPDDAVADLRAIASRMAAAGY
GRECAQVYASVRKPAVDASLRRLGVERLSIGDVQRLEWDALEAKIRRWIRAARAAVRGVF
ASERRLCFHIFHDLPISTTTISAASASATHDIPFAEAVKGAALQLFGFTEAISIGRRSPE
KLFKIIDLHDALSDLLPDVSDIFAASKVAESIYVQAVEIRSRLADAVRGILSEFENAVLR
DPPKTAVPGGTIHPLTRYVMNYSSLICDYKVTLSELIISRPSASARLSAEGNELAPSLAD
LELPELENQLPLASHIVWIIVVLEHNLEGKAALYKDPALSHLFMMNNVHYIVHKVKDSPD
LWSMIGDNYLKRLTTKFTMAATNYQRTSWLKILNCLRDEGLHVSGGFSSGISKSALRERF
KSFNAAFEDAHRVQSGWCVPDNQLREELRISIAEKLLPAYRSFLGRFRHHIENGKHPELY
IKFSVEDLEIAVSDFFEGVPPSPHNRRKSHG*

MDGSAAELEAAERVVMRWDSSLACGGTDEPMLFDGGGNRAEADRFLRAVDDLRRLAPPSP
AVVGSPRRLSSSSAARSGAVLVAMTRLEDEFRHVLSSRALDHEIEALADLSSLSINGDRS
NSASSADLSAADEDDSVSSSIGRRSTAYRSLRSIREIDLLPDDAVADLRAIASRMAAAEH
GRECAQVYASVRKPSVDASLRRLGVERLSIGDVQRLEWDALEAKIRRWIRAARAAVRGVF
ASERRLCFHIFHDLPISAASAPATHDTPFAEAVKGAALQLFGFAEAISIDRRSPEKLFKI
IDLHDALSDLLPDVSDIFAASKVAESIYVQAVEIRSRLADAVRGIFSEFENAVLHDPPKT
AVPGGTVHPLTRYVMNYSSLICDYKATLSELIVSRPSASARLAAEGNELVPSLADLELPE
LENQLPLASHIVWIIVILEHNLEGKATLYKDPALSHLFMMNNVHYIVHKVKDSPDLWGMI
ADDYLKRLTGKFTMAATNYQQASWLKILNCLRDEGLHVSGGFSSGISKSALRERFKSFNA
AFEDAHRVQSGWCVPDNQLREELRISIAEKLLPAYQSFLGRFRHHIENGKHPELYIKYSV
EDLEIAVGDFFEGVPPSPHHRRRSHG*

Other information
Ka divergence:0.494326KaKs divergence:0.600559
GC content 1 (%):62GC content 2 (%):63GC content divergence:0.008
Length 1 (bp):1896Length 2 (bp):1881Length divergence:-0.004
MFE 1 (kcal):-837.41MFE 2 (kcal):-835.7MFE divergence-0.001