Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G029863-GRMZM2G444845
Species:maize
Duplication type:WGD
Function (paralog1):protein binding protein
Function (paralog2):hypothetical protein LOC100382078

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7201683854399
Log2 mRNA fold difference:-2.8628307608414
Log2 TE fold difference:1.0526528208652
Sequences
Protein sequence

MLGASPRGRKAAAPPVKLGSAKEAPAAGGGGSGGKVPAEEVWEVRPGGMLVQKRGGGDDE
PSPNVKPVPTIRVKVKHAGVTHEIYISSEASFGELKKLVAAKTGLHPDDQKVLYKDRERD
SKVFLDTAGVRDRSKVVVLEDPEARARRLIGERRSGHLQKAARAVAAVTAEVDKLAPKVA
ALDASVRRGEKVAEKDVVQVTELLMNELLRLDAVVADGDVKAQRRMQVKRVQKYVETLDA
VAAKNAALVGKSGEKAAAKPAPAPAPAPAPPPRQQGQGQTRWEMFDLLSSLPSTSSASST
TTVSSTASSGAPPPSRPDWMLF*

MLGASASRGRKAAPPSVKLGAAKEAPATVAAAASGGKVSAEEVWEVRPGGMLVQKRGGAA
DDEPSPGVKPVRTIRVKAKHAGVTHEIYVSSEASFGELKKLVAAKTGLHPDDQKVLYKDK
ERDSKAFLDVAGVKDRSKVVVVEDPEARARRLIEERRNGHLQKAASAVAAVTAEVDKLAP
KVAALDASVRKGEKVAEKDVVQVTELLMNELLRLDAVVADGDVKAQRRMQVKRVQKYVET
LDAVAARNAATVRKSGAKPAPPPPQQQQQQARQARWEMLDLLSSLPSTSSASSTTTVSST
ASSGAPPTNRLDWMLF*

Other information
Ka divergence:-0.253009KaKs divergence:-0.113936
GC content 1 (%):72GC content 2 (%):71GC content divergence:-0.007
Length 1 (bp):969Length 2 (bp):951Length divergence:-0.009
MFE 1 (kcal):-532.4MFE 2 (kcal):-515.01MFE divergence-0.017