Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G030016-GRMZM2G053652
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193269
Function (paralog2):hypothetical protein LOC100274227

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.45792630662844
Log2 mRNA fold difference:-1.0841591310011
Log2 TE fold difference:0.60426358213164
Sequences
Protein sequence

MYTARKKIQKEKGLEPSEFEDSVAQAFFDLENGNQELKSDLKDLYINNAIQMDVTGSRKA
VVIHVPYRLRKAFRKIHVRLVRELEKKFSGKDVVIVATRRIVRPPKKGSAVLRPRTRTLT
AVHDGILEDVVYPAEIVGKRVRYRLDGSKIIKIFLDPKERNNTEYKLETCTAVYRRLCGK
DVVFEYPMTENA*

MYTARKKIQKDKGLEPSEFEDSVAQAFFDLENGNQELKSDLKDLYINGAIQLDVAGSRKA
VVIHVPYRLRKAFRKIHVRIVRELEKKFSGKDVVIVATRRIVRPPKKGSAVQRPRTRTLT
AVHDGILEDVVFPAEIVGKRVRYRLDGAKIIKIFLDPKERNNTEYKLDTYTTVYRRLCGK
DVVFEYPMAENA*

Other information
Ka divergence:-0.290252KaKs divergence:-0.999885
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):579Length 2 (bp):579Length divergence:0
MFE 1 (kcal):-214.9MFE 2 (kcal):-222.8MFE divergence0.018