Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G030123-GRMZM2G072238
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274340
Function (paralog2):hypothetical protein LOC100273899

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.87807555419606
Log2 mRNA fold difference:-0.37874709023777
Log2 TE fold difference:-0.49958120179134
Sequences
Protein sequence

MNRGEFQTSLVQQMIWSGGGGGNTTAAGSSNIMSSGFKQSCHEDQQEASRNLQLLPSLSS
PSSLLFSNAQQFPHTTSSGQQLAHTNAGGAAAGSLPSLDDDGGSGQDSHMPESWSQMLLG
EFAGERYAATACLLSKGVEDWGDHAAAAASACMVGGGGGVEEEGSAAMPLYSLYGGGSHS
HSHLAAAGDHEMPPAPAAAAAGANKSQLSQMLLASSPRSCVTTSLGSNMLDFSNNGVPPA
PDQLKSHHHHQSDNSSECNSTVTGSAIKKPRVQASSSAQSTLKVRKERLGDRITALHQIV
SPFGKTDTASVLQETIGYIRFLLGQIEALSYPYMGHGNGTSIQNGPTTGERNHAGLLPDQ
YPGQLLNHNNNTGARQPAAVGQPDEQQQQQGGANNNDETKKDLRSRGLCLVPVSCTSHFG
GDNAADYWAPAPLGGILR*

MNRGQFRASPLQQQVIWSADTATASSSSVVMSAFNFNSCHEDQEAFSPNNLPSLSSPSLL
FSHDQQQSFPHTGTTTTSPGHQLLANRGAAAGGCLPSLHDGGQENHHMPESWSQMLLAGL
VGGDQERCTAALLSKGMDDWGDHAATASAACMVGGGGTKKDEGSAVPQQPPYSFYGSHGH
LAAGGDEHEMPAPASKAQLSQMLLASSPRSCVTTSLGSNMLDFSNSAPPMELKRHHHHSD
NSSECNSTATAAGSAVKKPRVQAASSSAQSTLKVRKERLGDRITALHQIVSPFGKTDTAS
VLQETIGYIRFLLGQIEALSYPYMGHGNLTSSSTQNGPAGSERNPAGLFPEYPGQLLNHN
HNTGAQQQQPAAVQQPPDEKQGVDDEVKRDLRSRGLCLVPVSCTSHFGGDNAADYWAPAA
LGGMFR*

Other information
Ka divergence:0.00210941KaKs divergence:0.431895
GC content 1 (%):60GC content 2 (%):60GC content divergence:0
Length 1 (bp):1317Length 2 (bp):1281Length divergence:-0.014
MFE 1 (kcal):-537.96MFE 2 (kcal):-531.64MFE divergence-0.006