Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G030272-GRMZM2G060918
Species:maize
Duplication type:WGD
Function (paralog1):WRKY55 - superfamily of TFs having WRKY and zinc finger domains
Function (paralog2):hypothetical protein LOC100384435 (LOC100384435), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5637958756726
Log2 mRNA fold difference:-1.5439612435022
Log2 TE fold difference:0.032369663820476
Sequences
Protein sequence

MSPAPSSHHSQINSRKEKRMRKVDTFAPHNDGHQWRKYGEKKINNTNFPRYYYRCTYKDN
MNCPATKQVQQKDHSDPPLYAVTYYNDHSCNSAFLPLSPSEFQLQTSSGKAVSICFDSSS
GTAAAAAATTNASGGSPSSSAAAAAARRGTPPEVSNPPVLRRSETYPWGAGAVEQKPASC
STEYHDAFSAGAAAVPEEVVDAGRFGSIRFFHFL*

MSPAPSSHHSQTNSRKEKRMRKVDTFAPHNDGHQWRKYGEKKINNTNFPRYYYRCTYKDN
MSCPATKQVQQKDHSDPPLYAVTTTATTRATAPSSRSPPPSSSCGHRPGRPSPSASTPRP
GRRRPWRRSPPMLAAARPLPAPRRRGEARRRISVTRPTCGGLTLTRGAPAPWSRSWRPAP
PSATTPSRPAPCRRRW*

Other information
Ka divergence:0.83592KaKs divergence:-0.999443
GC content 1 (%):64GC content 2 (%):65GC content divergence:0.008
Length 1 (bp):645Length 2 (bp):591Length divergence:-0.044
MFE 1 (kcal):-279.39MFE 2 (kcal):-258.29MFE divergence-0.039