Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G030408-GRMZM2G034511
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275316
Function (paralog2):hypothetical protein LOC100276290

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.18125529887902
Log2 mRNA fold difference:-0.44440024428852
Log2 TE fold difference:0.35285137921544
Sequences
Protein sequence

MGIGYVVGVLGGAILAHAAYATIQYRAVLKITEEEFSRPPMDVMMELLLGLALCMWAGLA
VPAKFLSVLPHSEENRIVSFPANLDFMIFNHRGRALPSDSDLKLKT*

MGIGYVVGVLGGAILAHAAYATIQYRAVLKITEEEFSRPPMDVMMELLLGLVLCMWAGLA
VPTKFLSVLPHSDENRIVSLPANLDFMIFNHRGRALPSDSDLKLHT*

Other information
Ka divergence:0.620557KaKs divergence:0.724668
GC content 1 (%):58GC content 2 (%):57GC content divergence:-0.009
Length 1 (bp):321Length 2 (bp):321Length divergence:0
MFE 1 (kcal):-117.76MFE 2 (kcal):-113.2MFE divergence-0.02