Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G030422-GRMZM2G550865
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276114
Function (paralog2):hypothetical protein LOC100193888

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1636236475265
Log2 mRNA fold difference:0.123940484827
Log2 TE fold difference:-1.2604617744
Sequences
Protein sequence

MTSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNIKYFEDEVLNGNWDEVERYLGGF
TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT
LENFRENEQLSKYGDTKSARQIMLAELKKLIEANPLFRDKLQFPSLKTSRLRTLINQSLN
WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANSPLLGSMPKPGGFPPLGAHGPFQ
PAPTPVPPLAGWMSNPPAITHPAVSGGAIGFGTPTNPAVLLKHPRTPTTGNPGMDYPSGD
SDHISKRTRPVGMSEEMNLPVNMLPVTYPQSHNYQQDDFHKAVARTLSQGSAPMSMDFHP
LQQTLLLVGTNVGDIGLWDVGTKERLVVRNFKVWDLGKCTMTLQAALVKDPAVSVNRIIW
SPDGTLFGVAYSRHIVQIYSYNGGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCIITCGDD
KTIKVWEATSGAKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLGSRVD
YDAPGHWCTTMAYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRSMGVVQF
DTTRNRFLAAGDEFMIKIWDMDSTGLLTTIDADGGLTASPRIRFNKEGTLLAVSTADNGI
KILANADGLRLLRTLENRSFDASRNASEAVTKPLINPLTAAANAAAASSSGAGAPSAITA
MNGDSRSLVDVKPRIADESLDKSKVWKLMEITESSQCRSIKLADNMRTSKISRLIYTNSG
LAILALTSSAVHLLWKWPRSDRNSGKATASVSPTLWQPPSGILMTNDTTDNNPEEAVHCF
ALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPAPPAATFLAFHPQDNNIIAIGMDDSTI
QIYNVRIDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQKNRFLQI
PSGRQSNILDTRVQFHQDQMHFLVVHETQIAIYETTKLEPVKQWPVRENSPPITHATFSC
DSQLIYASFMDATVGIFNGSSLRLQCRILPASYLPPNISPSVHPVVVAAHPSEASQFALG
LTDGGVFVLEPLESERKWGNPPPVENGSASNLSTPPPNGASSSDQPER*

MAYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRSMGVVQFDTTRNRFLAA
GDEFMIKIWDMDSTGLLTTIDADGGLIASPRIRFNKEGTLLAVSTVDNGIKILANADGLR
LLRTLENRSFDASRNASEAVTKPLINPLTAAANAAAASSSGAGAPSAVTAMNGDTRSLVD
VKPRIADESLDKSKAWKLMEITESTQCRSIKLADNMRTSKISRLIYTNSGLAILALTSSA
VHLLWKWPRSDRNSGKASASVSPTLWQPPSGILMTNDTTDNNPEEAVHCFALSKNDSYVM
SASGGKISLFNMMTFKTMTTFMPAPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRIDEV
KSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQKNRFLQIPSGRQSNILD
TRVQFHQDQMHFLVVHETQIAIYETTKLEPVKQWPVRENSPPITHAAFSCDSQLIYASFM
DATVGIFNASSLRLQCRILPASYLPPNISPSVHPVVVAAHPSEASQFALGLTDGGVFVLE
PLESDRKWGNPPPVENGSASNLSAPPPNGASSSDQPER*

Other information
Ka divergence:0.311135KaKs divergence:-0.0595514
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):3387Length 2 (bp):1737Length divergence:-0.322
MFE 1 (kcal):-1068.37MFE 2 (kcal):-514.49MFE divergence-0.35