Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G030523-GRMZM2G108712
Species:maize
Duplication type:WGD
Function (paralog1):Proliferating cell nuclear antigen (PCNA)
Function (paralog2):proliferating cell nuclear antigen2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.030478354786478
Log2 mRNA fold difference:0.93477920834953
Log2 TE fold difference:-0.99617349873496
Sequences
Protein sequence

MLELRLVQGSLLKKVLEAIRELVNDANFDCSGTGFSLQAMDSSHVALVALLLRAEGFEHY
RCDRNLSMGMNLNNMAKMLRCAGNDDIITIKADDGSDTVTFMFESPKQDKIADFEMKLMD
IDSEHLGIPDSEYQAIVRMPSSEFMRICKDLSSIGDTVVISVTKEGVKFSTSGEIGSANI
VCRQNQTIDKPEEATIIEMQEPVSLTFALRYMNSFTKASSLSEQVTISLSSELPVVVEYK
IAEMGYIRFYLAPKIEDDEEMKP*

MLELRLVQGSLLKKVLEAIRELVTDANFDCSGTGFSLQAMDSSHVALVALLLRAEGFEHY
RCDRNLSMGMNLNNMAKMLRCAGNEDIITIKADDGSDTVTFMFESPKQDKIADFEMKLMD
IDSEHLGIPDSEYQAIVRMPSAEFMRICKDLSSIGDTVVISVTKEGVKFSTSGEIGSANI
VCRQNQTIDKPEEATIIEMQEPVSLTFALRYMNSFTKASSLSEQVTISLSSELPVVVEYK
IAEMGYIRFYLAPKIDDDEEMKP*

Other information
Ka divergence:-0.0027248KaKs divergence:0.0454545
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):792Length 2 (bp):792Length divergence:0
MFE 1 (kcal):-276.63MFE 2 (kcal):-288.15MFE divergence0.02