Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G030805-GRMZM2G075104
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.2200127592678
Log2 mRNA fold difference:-1.2517129533593
Log2 TE fold difference:-0.021783406581756
Sequences
Protein sequence

MASPSPASARPQRSPDEVEDIILRKILLVSLTPPANPSPAVAYLELTAAELLSESRPLLA
LRDAAERLLIDRLSLPDPPAGSPTPFAYLVSAFRRAADEARKISTIRDAALRARLAASIA
HLRALILSYARIVAGNPDTFPTPPGAQHPASDLLVFLLAEAADPLDPTPAPGAPPPPGFI
DEFLGSADYDSIEPAMGELYELLRQSVDKVSALGDFQRPLRLLRRLVGIPNCAKALVNHP
KWIPKNQIMLIGEGRVMELYSVLGAFFHVSAIRDREFASKPDVGQQCFSEASSRRPADLL
SSFTTIKSVMNGLYDGLKDVLLILLKNLDTREKVLEYIAEVINKNASRSGMQVDPLKCAS
SGMFVNLSAVMLRLCEPFLDNMEAKKDKIDVNYLFCNNRIDFKDLTAINASSEEVSSWIE
SINNEHAQNNASGEARFAESQEATSSGKNSTASQLRCSKKENFSFICECFFMTSRVLNLG
LMKAVSDFKHISQQLSRFEDDLESNRAVRDQGGGSPQLEQDITRLEKIVEILSQDKFCYE
AQILRDGAFLQRALSFYRLMILWSVNLVGGFKMPLPSQCPKEFACIPEHFLDDAMDLLVL
TSRIPKALESFVLDDFLSFIIMFMGSTSYIKNPYLRAKMVEVLNCWMPQRSGLNSTASLF
EGHQLCLDYLVGNLLKLYVDIEFTGSHTQFFDKFNIRHNIAELLEYLWDVPSHRNAWRQI
AKEEEKGVYLNFLNFLINDSIYLLDESLNKILELKEIEAEMANIVEWERRPAQEREERLR
VFHQWENIVRFDMRLANEDVGMLAFTSEQIPAPFLLPEMVERVASMLNYFLLQLAGPQRK
SLTVKDPEKYEFKPKQLLKQIATIYVHISRGDKESVFSAAISKDGRAYNDQLFSSAANIL
WKIGGDPKIIQEFVQLAGRAKAAASEAMDAEAILGDIPDEFLDPIQYTLMKDPVTLPSSK
VTVDRPVIIRHLLSDSTDPFNRSHLTQDMLIPNTELKLQIEEFVRSQQSRKRTAAALLEI
GEAEGTDDMAE*

MAFSSPASARPQRSPDEVEDIILRKILLVSLTPLANPGPAVAYLELTAAELLSESRPLLA
LRDAAERLLIDRLSLPDPPAGSPTPFAFLVSAFRRAADEARKISTIRDAALRARLAASIA
HLRALILSYARIVAGNPDTFPSQPGAQHPAAELLVFLLAEAADPLDPTPGPGAPPPPGFI
DEFFSGADYDSIETAMGELYELLRQSVDKVSALGDFQRPLRVLRRLVGIPNCAKALVNHP
KWIPKNQIMFIGEGRVMELYSVLGAFFHVSAIRDREFASKPDVGQQCFSEASSRRPADLL
SSFTTIKSVMNGLYDGLKDILLTLLKNLDTREKVLEYIAEVINKNASRSGMQVDPLKCAS
SGMFVNLSAVMLRLCEPFLDNMESKKDKIDVKYLFCNNRIDFKDLTAINASSEEVSSWIE
SINNEHAQNNASGEARFVESQEATSSGKNSASSQLRCSKKNFSFVCECFFMTSRVLNLGL
MKAISDFKHISQQLARFEDDLESNRAVRDQGGGSPQLEQDITRLEKIVEILSQDKLCYEA
QILRDGAFLQRALSFYRLMILWSVNLVGGFKMPLPSQCSKEFACIPEHFLDDAMDLLVLT
SRIPKALESFVLDDFLSFIIMFMGSTSYIKNPYLRAKMVEVLNCWMPQRSGLSSTASLFE
GHQLCLDYLVRNLLKLYVDIEFTGSHTQFFDKFNIRHNIAELLEYLWDVPSHRNAWRQIA
KEEEKGVYLNFLNFLINDSIYLLDESLNKILELKEIEAEMTNTVEWERRPAQEREERLRV
FHQWENIVRFDMRLANEDVGMLAFTSEQIPAPFLLPEMVERVASMLNYFLLQLAGPQRKS
LTVKDPEKYEFKPKQLLKQIATIYVHISRGDKESVFPAAISKDGRAYNDQLFASAANILW
KIGGDPKIIQEFMQLAGRAKAAASEAMDAEAILGDIPDEFLDPIQYTLMKDPVTLPSSKV
TVDRPVIIRHLLSDSTDPFNRSHLTQDMLIPNTELKLQIEEFVQSQQLRKRTAAVSEIGQ
ADGADDMAE*

Other information
Ka divergence:0.134886KaKs divergence:-0.0780205
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):3096Length 2 (bp):3090Length divergence:-0.001
MFE 1 (kcal):-1048.17MFE 2 (kcal):-1039.38MFE divergence-0.004