Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G030902-GRMZM2G060977
Species:maize
Duplication type:WGD
Function (paralog1):heterogeneous nuclear ribonucleoprotein 27C
Function (paralog2):hypothetical protein LOC100193201

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.33150495203273
Log2 mRNA fold difference:-0.95245561351892
Log2 TE fold difference:0.62224915518064
Sequences
Protein sequence

MATKLVVLGIPWDVDTEGLREYMAKFGPLDDCVVMKERSSGRSRGFGYVTFASADDAKNV
LDCEHVLGSRTLEVKIATPKEEMKSQGTKKATRIFVARIPQSVDESMFRRHFEAFGEILD
LYMPKEHGSKGHRGIGFITFQSAESVDSIMQESHELDGTTVVVDRATPKEEDVRYPPSRP
SQGGYGAYNAYISAATRYATLGAPTLYDHPGSAYGRGYYGSSQAVGKKIFVGRLPQEANT
DDLRHYFGRFGRIVDAYIPKDPKRSGHRGFGFVTFADEGVAERVSRRSHEILGHEVAIDT
AAPLENDSAGGGYIDPMDLYGAYGSMRSFGRFCGGLDYNYGYGPSSGSSRSRSDWRYRPY
*

MATKLVVLGIPWDVDTEGLREYMAKFGPLDDCVVMKERSSGRSRGFGYVTFASADDAKNV
LDCEHVLGSRTLEVKVATPKEEMKSQGSKKATRIFVARIPQSVDESMFRRHFEAFGEILD
LYMPKEHGSKGHRGIGFITFQSAESVDNIMQESHELDGTTVVVDRATPKDEDVRYPPSRP
SQGGYGAYNAYISAATRYATLGAPTLYDHPGSAYGRGYYGPSQAVGKKIFVGRLPQEANT
DDLRQYFGRFGRIVDAYIPKDPKRSGHRGFGFVTFADDGVAERVARRSHEILGHEVAIDT
AAPLENDSAAGGYIDPMDLYGAYGSMRSFGRFCGGLDYNYGYGPSSGSSRSRSDWRYRPY
*

Other information
Ka divergence:0.569013KaKs divergence:0.449393
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1083Length 2 (bp):1083Length divergence:0
MFE 1 (kcal):-352.38MFE 2 (kcal):-352.61MFE divergence0