Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G030915-GRMZM2G145258
Species:maize
Duplication type:TD
Function (paralog1):40S ribosomal protein S3a
Function (paralog2):hypothetical protein LOC100273118

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.85372060235051
Log2 mRNA fold difference:1.210947991373
Log2 TE fold difference:-0.34118889277873
Sequences
Protein sequence

MPRSTHMGHTASCASIRSCVPADRMIEPGNPRIVYSSPLCLRSAFSRRAADNSLPSETPS
TSAAAAAAAAATMAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPSVFSVRNIGKTLV
SRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTD
KLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKM
VEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKL
MEVHGDYKEDVGVKLERPVEGDEAVQEVAAAE*

MAVGKNKRISKGKKGGKKKTVDPFSKKDWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEG
LKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTL
IEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEIMINQASTCD
LKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVG
VKLERPVEGDEAGQEVAAAE*

Other information
Ka divergence:-1KaKs divergence:-0.996055
GC content 1 (%):52GC content 2 (%):49GC content divergence:-0.03
Length 1 (bp):999Length 2 (bp):783Length divergence:-0.121
MFE 1 (kcal):-350.9MFE 2 (kcal):-269.02MFE divergence-0.132