Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G030955-GRMZM2G162949
Species:maize
Duplication type:WGD
Function (paralog1):RING zinc finger protein-like
Function (paralog2):RING zinc finger protein-like

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.47148420987964
Log2 mRNA fold difference:0.035825978567507
Log2 TE fold difference:-0.53350474243449
Sequences
Protein sequence

MWGFASNAWAAGLEKRSSPNRTSSSAAYSDDEASSCTSREEGLECPICWESFNIVENVPY
ALWCGHTMCKNCILGLQWAVIKVPTVPIQLPFFICCPWCNLLSPRVLYKGNLTFPRKNYF
LLWMVEGMNGERARSRPAIRSEQHTPWLSSSSSVANGNAGCSNPTRRHLPPPSVDTSPTN
ANHANYGGSPLLNAGRVQASLRKSLSFLVHLTAKFPLVFVFLLIVLYAIPASAAVLLLYI
LITVLFALPSFLILYFAYPSLDWLVREIFA*

MWGFASNAWASGLGKRSPPNCTSSSAACSDDEASSCTSREEGLECPICWESFNIVENVPY
VLWCGHTLCKNCVLGLQWAVIKVPTVPMQLPFFVCCPWCNLLSLRILYKGNLTFPRKNYF
LLWMVEGMNGERARSRPATHSEQHTPWLSSSSRANGNAGCSNPTRRHLPLPPPVDTTSPT
NANHANHGVPVPLLNAERVQASLRKSLSFLVHLTAKFPLVFIFLLIVLYAIPASAAVLLL
YILITVLFALPSFLILYFAYPSLDWLVREIFA*

Other information
Ka divergence:-0.481018KaKs divergence:-0.320642
GC content 1 (%):55GC content 2 (%):53GC content divergence:-0.019
Length 1 (bp):813Length 2 (bp):819Length divergence:0.004
MFE 1 (kcal):-275.3MFE 2 (kcal):-266.22MFE divergence-0.017