Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G031028-GRMZM5G870446
Species:maize
Duplication type:WGD
Function (paralog1):plastid-lipid-associated protein 2 (LOC100284078), mRNA
Function (paralog2):LOC100284083

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.45079569497669
Log2 mRNA fold difference:-1.8660234547215
Log2 TE fold difference:1.411473788307
Sequences
Protein sequence

MASSAFLNALVLRSPSPSLSSSSNRRSTGAFAFPNPPRFPCLRSARRLVLARAAAAPAPG
DGPEDEWGPEPEGGSAVTGAAVAEAPEAREVAELKAQLKDALYGTERGLRASSESRAKVL
ELITQLETRNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGFGNLPQLVKVEEISQTIDS
ENFTVQNCIKFSGPLATTSVATNAKFEIRSPKRVQIKFDEGIVGTPQLTDSIVLPEKFEL
FGQNIDLSPLKGIFSSIENAASSVAKTISEQPPLKIPIRTNNAESWLLTTYLDEELRISR
GDGSSIFVLFKEGSTLLY*

MAGSALLNALVLRAPSPSLSSSSKRRSAGAFVSSNPPRFPSLRSERRVALPRAAAGGDPE
DEWVPEPEGGSAVTGTAVAEAPEAGEVAELKAQLKDALYGTERGLRASSESRAKVLELIT
QLETRNPTPAPTEALTLLNGKWILAYTSFSQLFPLLEFGKLPALVKVEEISQTIDSKNFT
VQNCIKFSGPLATTSVSTNAKFEIRSPKRVQIKFDEGIVGTPQLTDSVVLPEKFEVFGQN
IDLSPLKGIFSSIENAASSVAKTISGQPPLKIPIRANNAESWLLTTYLDEEVRISRGEGG
GIFVLFKEGSTLLN*

Other information
Ka divergence:0.221603KaKs divergence:0.745518
GC content 1 (%):56GC content 2 (%):58GC content divergence:0.018
Length 1 (bp):957Length 2 (bp):945Length divergence:-0.006
MFE 1 (kcal):-372MFE 2 (kcal):-368.93MFE divergence-0.004