Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G031053-GRMZM2G098129
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100272243

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.98844856631777
Log2 mRNA fold difference:-1.7812325504126
Log2 TE fold difference:0.7904355976487
Sequences
Protein sequence

MLQMLGFRGGSPSTGDASPAISGDGGAAARPLRLVYCDDKGKFVMDPEAVAALQLVKGPV
GVVSVCGRARQGKSFILNQLLGRSGGFQVASTHRPCTKGLWMWSAPLKRTGLDGTEYSLV
LLDTEGIDAYDQTGTYSIQIFSLAVLLSSMFIYNQMGGIDESALDRLSLVTEMTKHIRVR
ASGGSCTSSYKPSNINLRPCYASDTFGVRRADDTVLPLLQDFYLDLAEDNRKITPRDYLE
LALRPVQGGGRDISAKNAIRDSIRALFPDRECFTLVRPVNNEKDLQRLDQLPIALETYLH
FKQFDGIYKLCLSLHDLSNFRPEFRSGLDAFTKFVLDRTRPKQLGATTMTGPILAGLTQS
FLDAINNGAVPTISSSWQSVEEAECQRAFDSAVGTYNSSFDHKKHIEEDSLREAHEDAMR
KAISAFNVSAVGAGRQLEHIDAERNALRLKCNSSDDKLALLRKQLEASESHRAEYVRRYE
EVLNDKQKISKDYSIRITELQAKSSKLEQRCLSLSSSLETAKRESNDWKSKYDHGILQQK
ADESKLKSQIASLESRVSISEGRLSATREQADSAQEEASEWKRKYEVAVSEAKTALQRAA
VAQERTNKKVQEREDALRVELANQLSEKEEEIARLHAKRSQMEIHATSLISRLEATEAKS
KSHESDSLALREEIRLLTDNLESIRSEALSREKEVGILEQEKNHLEEKYLSQCKKFDETD
IRCKEAEREAKRATELADVARVEASAAQKDKGEAQRLAMERFALIERMERQVEALERDKA
KLVEEIERLHQSEKDAVSKVALLERNVGEREKEIDEMLKQNNQQRSSTVQVLESLLATER
EARAEANKRAEELSLMLQATQGKLDMLQQETTLDSKLKTSARRLRGDATESVHDMDIDGD
NGRRRKRSKSTTSPFKNNHTEDGGSVFIGEDTYNGSQQGTESEDYTKFTVLKLKQELTKH
GFGAQLLQLKNPNKKDIVALYEKHVIGK*

MFQMLGLRGGSPSAGEATPVMSGDGGAVAGPARPLRLAYCDEKGRFVMDPEAAAALQLVK
GPVGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWMWSTPLKRTGLDGTEY
SLVLLDTEGIDAYDQTGTYSIQIFSLAVLLSSMFIYNQMGGIDEAALDRLSLVTEMTKHI
RVRASGGRSTASELGQFSPVFVWLLRDFYLDLTEDNRKITPRDYLELALRPVQGGGRDIS
AKNAIRESIRALFPDRECFTLVRPVNNEKDLQRLDQLSLSNFRPEFRSGLDTFTKFVLDR
TRPKQLGASTMTGPILAGLTQSFLDAINSGAVPTISSSWQSVEEAECRRAFDSAVGTYNS
SFDHKTYIEEDSLREAHEDAMRKAISVFNASAVGAGSARLKFEKLLHSSLKKAFEDYKRN
AFLEADLQCSNRVQNMESKVRAACNRPDAKLDDIIRLLDGLLTEYESKAYGPGKWKMLVT
FLQQCIAGPVLDFFKRQLEHIDAERNALRLKCNSSDDKLALLRKQLEASEGHRAEYVRRY
EEVLNDKQKISKDYSTRITELQIKSSKLEERSLSLSSSLETAKRESNDWKSKYDHGILQQ
KADESKLKSQIASLESRVNISEGRLSATREQADSAQEEASEWKRKYEVAVSEAKTALQRA
AVAQERTNKKVQEREDALRSELANQLSEKEEEIARLHAKLSQTEIHATSLISRLEATEAK
LKSHESDSLALKEEIRLLTDNLESVRSEAMSREKEVRILEQEKNHLEEKYLSQCKKFDEI
DIRCKEAEREARRATELADVARTEASSAQKDKGEAQRLAMERLALIERIERQVEALERDK
AKMVEEIERLHQSEKDAVSKVALLERSVDEREKEIDEMLKRNNQQRSSTVQVLESLLATE
REACAEANKRAEDLSLMLQATQGKLDMLQQETTLDSKLKTSARRLRGEGTESVHDMDIDE
DNGRRRKRSKSTTSPLKSNHTEDGGSVFIGEDTCNGSQQGTETEDYTKFTVLKLKQELTK
RGFGAQLLQLKNPNKKDIVALYEKHVVGK*

Other information
Ka divergence:-0.215117KaKs divergence:-0.232375
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):2967Length 2 (bp):3150Length divergence:0.03
MFE 1 (kcal):-969.96MFE 2 (kcal):-1055.31MFE divergence0.042