Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G031062-GRMZM2G342856
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):N-acetyltransferase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.3442653518796
Log2 mRNA fold difference:-3.1853151651879
Log2 TE fold difference:1.9038397685367
Sequences
Protein sequence

MEATATPRTQEVMKPEPGTVKVTVDEVTLRKFELSDVDAMMAWASDPQVAALCRWEPYES
TEPLLAFIRDVVLPHQWFRAICLGSEPRPVGAVSVSPTGDPCRAELGYVLARAHWGRGVA
TAAVKRTVTAVFGEVPGLERVEALVDVANLASQRVLEKAGFTREAVLRKYGANKGVVRDK
VMCSFIDPDAVPE*

MEATATPRTQEVMKPEPGTAKVTVDEVTLRKFELSDVDAMMAWASDPQVAAVCRWEPYES
TEPLLAFIRDVVLPHPWFRAICLRGEPRPVGAVSVSPTGDPCRAELGYVLARAHWGRGVA
TAAVKRTVATVFAEVPGLERVEALVDVANPASQRVLEKAGFTREAVLRKYGAIKGVVRDM
VMSSFIDTDPVPE*

Other information
Ka divergence:-0.545725KaKs divergence:0.387783
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):582Length 2 (bp):582Length divergence:0
MFE 1 (kcal):-299.9MFE 2 (kcal):-318.7MFE divergence0.03