Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G031398-GRMZM2G105004
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100191188

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.822857174797
Log2 mRNA fold difference:1.7331991043375
Log2 TE fold difference:-0.91036491790885
Sequences
Protein sequence

MDIGQGATILVSAGWLYSPFSSSSPSGRRQLRRCCWSWAKGGGTDVLPFDFPLAGRSSTS
DDRASRRSDLACWARQEDGALVRPRAHTPMGDRRTGSRHYASARTLSVGAPSSSPSRQCG
GKILFSQKTVLFFISCPELNTVLQIHISLLGVDKDLCLNEWSKTMDVPTPPNRAGCNSNI
SNIGSPMQSFDDPFGGAAMTSFDGYSELSSPSVADHIFSLLNDPSSVQHMFALWSSSGSS
PRASAVREDMSFDTYPGPMDVTASLAQRINSASVFNPTEVDRGLKDSDGLVPNNGSQQGS
SIIPRSVGNILADRMLMALSLFRKSLSDGVLAQVWMPVEHNGRVVLSTSEQPYLLDQDLA
GYREVSRNFLFSVKEEPGLHLGLPGRVFISGVPEWTSSVTYYSKPEYLRMEHALLHEIRG
SLAMPVYDPSKGSCCAVLELVTNKEKPDFDAEMDIGVNLQTTTDRSNQKVYSENQKYAST
EILDVLRAICHAHMLPLALTWIPTSNGTANGFCVAKNIRLDSQPGKSVLRIHESACYVND
AKMQGFLHACAERHLEKGQGIAGRALKSNLPFFSPDIREYSIEDYPLAHHARKFGLHAAV
AIRLRSTYTGKDDYILEFFLPVNCKGCGEQQMLLNSLSSTMQRICKSLRTVSEAETDSVS
ATEPMYEKTNGSCLPTGNSESSSHDDQPITESAFHDLSSGDKQGDREPAKARSSSKRVAE
KKRSTSEKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKINKVNRS
LKKIEKVIKSVHGVDRSLQYDPATGSLVPATSLPDKMPTSSAGVKTVEEKSSPEPGQDFS
SPDGWQRESSQLHASSIPTRVGDEVQMLAINNEGSRNYASGIANIAQHSNSEDAHGPLYP
VGAVNSSRTGETGYIDSPTSLHMDSVEGQTTVRDSRSVQQADVTMATKEQTLPSTSGTTD
SSSGSASSQPAFKGNPGRALKVSSSDALTVKATCNGDTVRFKFLPAMGWYHLLEEVAKRF
KLATGAFQLKYKDDEDEWVILANDADLQECVDVLDSIGSRSVKLQILFLTNLLVVKPRCD
MALPSRCSHEMLGKNQGEKVGGTSRGRHNNMWRGIGSRGVVAGWHRVEWEMHKKGMEIRR
AQGRRRGQRVRVTQQEARDRDREGSRKMWVVMVKEEGIVGDECFDGLDRGIGQL*

MDVPTPPNRAGCNSNIGSPMQSFDDPFGVAAMTSFDGYSELCSPSVADHIFSLLNDPSAA
QQMVAMWSSLGSSPRASAVREDMSFDTFPGPVDGTSSLAQRFNSAAASSPTGVDRGLKES
DGLVLPSNGSQQGSSIIPRSVGNALADRMLMALSLFRKSLSDGVLAQVWMPVEHNGRVVL
STSEQPYLLDQDLAGYREVSRNFLFSVKEEPGLHLGLPGRVFISGVPEWTSSVIYYSKPE
YLRMEHALLHEIQGSLAMPVYDPSKGSCCAVLELVTNKEKPNFDAEMDIVCDALQAVNLQ
TTTDRSNQKVYSENQKSAFTEILDVLRAICHAHMLPLALTWVPTSNGIANGFCVGKNIGI
DPQPGKAALRIHESACYVNDAKMQGFLHACADRHLEKGQGIAGRALKSNLPFFSPDIREY
SIEDYPLAHHARKFGLHAAVAIRLRSTYTSYDDYILEFFLPVNCKGCGEQQMLLNNLSST
MQRICKSLRTVSEAEIENVSATAAMFEKTSGTCLPTGNSESSSHDDQPITESALQDLSLG
DKQGDREPDKPQRSSMRVADKKRSASEKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRI
CRQHGISRWPSRKINKVNRSLKKIEKVIKSVHGVDRSLQYDPATGSLVPATSLPEKMPFS
ACDTLPTSSLGRAVEETCSPKSEQDFSSPDGWQRETSQFHVSGIPKRGGDEVRTLANNNK
GRRNYVSGIANITQHSNSEGTHGPSYPNPIGAVNSLHTGETGNIDSLTSLHPSMDGIEGQ
TTVRNSPFVQQADVTMVDGHDTKEQTLPSTSGMTDSSSGSASSEPTFKGNPGRALKDRSS
PALTVKATYNGDTVRFKFVPARGWYHLLEEIAKRFKLTAGAFQLKYKDDEDEWVILANDA
DLQECMDVLDSISSRNMKLQVRDLSCHVGSSGSSSSCLQVEAHSS*

Other information
Ka divergence:-0.167432KaKs divergence:-0.103801
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):3585Length 2 (bp):2838Length divergence:-0.116
MFE 1 (kcal):-1245.46MFE 2 (kcal):-960.65MFE divergence-0.129