Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G031496-GRMZM2G097190
Species:maize
Duplication type:WGD
Function (paralog1):nucleotide-binding protein 1
Function (paralog2):nucleotide-binding protein 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.61936953124
Log2 mRNA fold difference:-3.9778966342547
Log2 TE fold difference:2.3709989397104
Sequences
Protein sequence

MENGGAKGDVPDDANEHCPGTQSEEAGKADACAGCPNQQICATAPKGPDPDVVAIVERLA
TVKHKLLVLSGKGGVGKSTFSAQLSFALAEMDHQVGLLDIDICGPSIPKMLGLEGQDIHQ
SNLGWSPVYVESNLGVMSIGFMLPNPDDAVIWRGPRKNGLIKQFLKDVDWGEIDYLVVDA
PPGTSDEHISIVQYLQATGIDGAIIVTTPQQVSLIDVRKEINFCKKVGVPVLGVVENMSG
LRQPLSDLRFIKSDEAGKTDATEWALNYIKEKAPELLSVMACSEVFDSSKGGAEKMCHEM
GVPFLGKVPMDPQLCKAAEEGRSCFADQKCSASAPALRNIVKKLIKAE*

MENGGGKGDVPNDANEHCPGTQSEEAGKADACAGCPNQQICATAPKGPDPDVVAIVERLA
TVKHKLLVLSGKGGVGKSTFSAQLSFALAEMDHQVGLLDIDICGPSIPKMLGLEGQDIHQ
SNLGWSPVYVESNLGVMSIGFMLPNPDDAVIWRGPRKNGLIKQFLKDVDWGEIDYLVVDA
PPGTSDEHISIVQYLQATGIDGAIIVTTPQQVSLIDVRKEINFCKKVGVPVLGVVENMSG
LRQPLSDLSFVKPGEAGETDATEWALNYIKEKAPELLSVMACSEVFDSSKGGAEKMCREM
GVPFLGKVPMDPQLCKAAEEGRSCFSDQKCGASAPALQSIVKKLIKTG*

Other information
Ka divergence:0.0111057KaKs divergence:0.286754
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):1047Length 2 (bp):1047Length divergence:0
MFE 1 (kcal):-384.71MFE 2 (kcal):-394.5MFE divergence0.013