Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G031628-GRMZM2G031660
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100272792

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.4570250577842
Log2 mRNA fold difference:0.076219143966062
Log2 TE fold difference:1.3159548623279
Sequences
Protein sequence

GYAQGGDGYTTRAEDSLDDQGRIRYLEGYLAKLAKVISDGADVRGYFIWYLIDNFEWLYG
YTLRFGLHYVDYQTQERKPKSLALWYKRFLQSSLEAQ*

MAGRARARRFVLAGALMIAWLLCLLPRATAAAVRRSDFPPSFLFGTATSSYQIEGAYLEG
NKSLSNWDVFSHVPGRIEDGSTGDVADDHYHRYEDDIELMHSLGTNAYRFSISWARILPR
GRFGEVNPAGIAFYNRLIDSLLLKGIEPFVTLSHYDIPQELEDRYGAWLGGAEARRDFGH
LADVCFAAFGDRVRHWATFNEPNVAVTRGYMLGTYPPGRCSRSCARGNSDAEPYVAAHNV
VLAHAAAVQIYKTKYQSKQKGLIGIVMSTVWFVPLTDAPADRLATERALAFDVPWFLDPI
IYGDYPPEMRRLLGSRLPTFSPEERRTLGYGLDFIGINHYTTLYARDCMISPGYCPSGQE
FHQSLAAYTGERDGIPIGPPTAMPTFYVVPDGIEKMVTYIMNRYSNLPMFITENGYAQGG
DGYTTRAEDWLDDQGRIQYLEGYLAKLAKVISDGADVRGYFIWSLIDNFEWLYGYTLRFG
LHYVDYQTQERKPKSSALWYKRFLQSSLEAQ*

Other information
Ka divergence:-1KaKs divergence:-1
GC content 1 (%):54GC content 2 (%):61GC content divergence:0.061
Length 1 (bp):294Length 2 (bp):1536Length divergence:0.679
MFE 1 (kcal):-98.7MFE 2 (kcal):-637.8MFE divergence0.732