Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G032071-GRMZM2G415012
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100191882

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.061271521720504
Log2 mRNA fold difference:-0.043327965538305
Log2 TE fold difference:0.13013211357135
Sequences
Protein sequence

MPPRRGRRKGKGRAKPRAKATEPEPELEEAADSEIEAGDAKAEESGEAKEDESASDAESM
DADANEEAVENGADEMDAEPEAKAEPEAVATEAEAKPDVSDAEDEEAGETCSDREADAKD
VDSKAKAEESDGEDEEGATAETDGEDEEGATAETDGESEEEAAETGGENEEDGGDSDTEG
DAEESPPPPPSRSRRRKRAATPDDEAEETPTPSRRRRRRKSRQRGDSPPPLPDHLRCRRS
DGKKWRCSGRALPTVSFCEYHYARANKGKKLPADGELLAVALQRQKNKRKGRRRINPSTS
PQAATSDRQTRDLPNGLMTILPGSSGPAALSTPVTTKVGVEISAPMQRCYRSKNAEPLPV
GPVKVVPRAMSMTKAAPRMCHCCGVKKAARVANCKNCDTNFCNSCINKWYSKLSRKDIKA
RCPACRGLCNCKLCSLGHTKGATHKEPPSGERKILSIKISNHQFYKLLPVKLDREQLDEL
ELEAKIQGTKTSNVRVQVAENGQSESLYCNNCKLSVSQFLRCCPTCPFKLCLSCCQKIRQ
GNMSNSNPEDKFKNRLLQQESVHEDGSITCPSIELGGCGDAMLNLIYASPSSQSEELSSE
CELDAAGNHSGVKDAEVHGSPVPESNGRLAAASQAETMST*

MPPRRGRGKGKGRAKPRAKPTEPEPESDPELDEAAKSEIEAGDAEAGEESSAESEDSKED
ESESDTESMDAEASEEAGENGTEEMDAEPEAKAVEAKAETVATEAEAKPDASDEEAGETG
SDREADGKGADPKAKAEESDGEDEEGATAVTDGDSEEEAAETGGESEEDGGDSDTEGDAE
ESPPSPPRRSRRRKRAATPDDEAEETPTPSRRRRRRKSGERGDSPPPLPDHLRCRRSDGK
KWRCSGRALPTVSFCEYHYARANKGKKLPADEEVLAVVLQRQKNKRKGRRSINPPTSPQA
ATSDPQTRDLPNGLMTISPGSSGPAALSTPVKIGVEIPAPIQRCYRSKNAEPLPVGPVKV
VPRAMSVTKTARTCHCCGMKKAARVANCKNCDKNFCNSCINKWYSKLSRKDIKARCPACR
GLCNCKPCSLGNSKGSTPKEPPKVERKILSIKISNHQFYKLLPVRLDQEQLDELELEAKI
QGTKISNVCVQVAETGQSESLYCNNCKLSMSRLLRCCPTCPFKLCLSCCQKIREGNMSDN
TPEDKFKNRLIQQESVHEDGSITCPSIELGGCGDAMLNLIYSSPSSQSEELSSECELDAA
GNHSGVKDAQAHGSPVPESNGRLLAAAQAETVSEE*

Other information
Ka divergence:0.0428944KaKs divergence:-0.11795
GC content 1 (%):55GC content 2 (%):54GC content divergence:-0.009
Length 1 (bp):1923Length 2 (bp):1908Length divergence:-0.004
MFE 1 (kcal):-715.16MFE 2 (kcal):-742.56MFE divergence0.019