Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G032107-GRMZM2G095964
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278084
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.56272478454114
Log2 mRNA fold difference:-0.20647996222039
Log2 TE fold difference:-0.26848852987906
Sequences
Protein sequence

METSSHKRAREAVDLAAAAGEAVWPEADAKRLRPQDLLDMLDDDTEAAAAGDLASVMRSL
EEEIASFDEAAEAAPSQQPELGFLLEASDDELGLPPAGSAAAASSEEAGLAGPPEPAAAL
YGQIWGFDDEIDGGFGGYSPEAAAAAAAAAAWDDDVFGAGLFAFGDDACAPSDLAALRHE
SMPAV*

MENSSHKRAREAGDLVAGGCGEEGSPQADAKRLRPQDLLDMLEDDTDAAAAGDLASVMRS
LEEEIASFDEAAEAPAPAPELGFLLEASDDELGLPPASSSEEEEAGRAGAPFPPALDGQI
WGFEDEIVDGGGFGGYSPEAAAAAAASAAAAAWDDDGFGAGLFAFGGDDACGPSDLAALR
HETMPAV*

Other information
Ka divergence:0.202329KaKs divergence:-0.113617
GC content 1 (%):75GC content 2 (%):75GC content divergence:0
Length 1 (bp):558Length 2 (bp):564Length divergence:0.005
MFE 1 (kcal):-315MFE 2 (kcal):-349.2MFE divergence0.051