Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G032182-GRMZM2G053908
Species:maize
Duplication type:WGD
Function (paralog1):mitochondrial RNA-splicing protein MRS3
Function (paralog2):hypothetical protein LOC100279505

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.90104048260848
Log2 mRNA fold difference:-2.4162013690455
Log2 TE fold difference:2.0834121872488
Sequences
Protein sequence

MAADFRTPDRLLPAATEEPTTPQGHPPNPVLSTPTVPDATHDGLRFWQYMLAGSVAGVVE
HTAMFPVDTLKTHMQASTPPCRPTLSLRAALRNAVAGEGGALALYRGLPAMAFGAGPAHA
VYFSVYEFAKSALTDRLGPNNPAAHAASGVVATVASDAVLTPMDTVKQRLQLTSSPYTGV
GHCIRTVLRDEGPSAFFVSYRTTVVMNAPYTAVHFATYEAAKRMLGDMAAEEESLAVHAT
AGAAAGALAAAVTTPLDVVKTQLQCQGVCGCERFSSSSIGDVFRTIIKRDGYSGLMRGWK
PRMLFHAPAAAICWSTYEASKSFFQRFNEERRK*

MAADFRTPDRLLPATAEEPTTPQGRPPSPVLSSPAVPDATHDDLRFWQYMLAGSVAGVVE
HTAMFPVDTLKTHMQASAPPCRPALSLRAALRNAVAGEGGALALYRGLPAMALGAGPAHA
VYFSVYELAKSALTDRLGPNNPAAHAASGVVATVASDAVFTPMDTVKQRLQLTSSPYTGV
GHCVRTVLRDEGPSAFFVSYRTTVVMNAPYTAVHFATYEAAKRMLGDIAAEEESLAVHAT
AGAAAGALAAAVTTPFDVVKTQLQCQGVCGCERFSSSSIGDVFRAIIKRDGYSGLMRGWK
PRMLFHAPAAAICWSTYEALKSSFGRFNEERRK*

Other information
Ka divergence:0.129911KaKs divergence:-0.0509649
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):1002Length 2 (bp):1002Length divergence:0
MFE 1 (kcal):-433.3MFE 2 (kcal):-459.16MFE divergence0.029