Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G032564-GRMZM2G152573
Species:maize
Duplication type:WGD
Function (paralog1):60S ribosomal protein L34 (LOC100286075), mRNA
Function (paralog2):60S ribosomal protein L34

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.65671862884148
Log2 mRNA fold difference:1.1418035860846
Log2 TE fold difference:-0.46470419561764
Sequences
Protein sequence

MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA
EYKRSRLARNRRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVKKVLKIQKTKDKASKN*

MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA
EYKRSRLARNQRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVKKVLKIQKTKDKASKS*

Other information
Ka divergence:0.341356KaKs divergence:0.362146
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):360Length 2 (bp):360Length divergence:0
MFE 1 (kcal):-122.7MFE 2 (kcal):-119.1MFE divergence-0.015