Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G032694-GRMZM2G072107
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383522
Function (paralog2):hypothetical protein LOC100276919

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.2222481547176
Log2 mRNA fold difference:-1.1817844654055
Log2 TE fold difference:-0.035758738633031
Sequences
Protein sequence

MEHVVGGKFKLGKKIGSGSFGELYLAVNVQNGEEVAVKLESVTSRHPQLHYESKLYMLLQ
GGTGIPHLKWFGVEGQYNVMVIDLLGPSLEDLFNYCSRKFSLKTVLMLADQMISRVEYMH
TRGFLHRDIKPDNFLMGLGRKANQVFVIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYA
SVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDRISEKKMLTPVEVL
CKSYPSEFTAYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQLDYVFDWTIMKYPQFRD
KSKIQSSGKMSGLAGPSAERTDRTAAEALFRRTGSGSGHNREHTKHRSLLESLMPSKVAV
DSDKARPQSSSRNGSTSRRAVISSSKPSSSGDLSDPNRLGGRLAPSSSSRPPTAQREIRS
SSLSKIGRSSHDDAIRNLELLSLGADKRK*

MEHVVGGKFKLGKKIGSGSFGELYLGVNMQSDEEVAVKLESVKSRHPQLHYESKLYMLLQ
GGTGIPHLKWFGVEREYNVMVIDLLGPSMEDLFNYCSRKFSLKTVLMLADQMISRVEYMH
TRGFLHRDIKPDNFLMGLGRKANQVFVIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYA
SVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDIISEKKMLTPVEVL
CKSHPSEFTAYFHYCRSLRFEDKPDYSYLKRLFRDLFLRKGYQLDYVFDWTIMKYPQFRD
KNKFQSSGKTSGLAGPSAERTNRTAAEALFRRTRSGSGHNREHTKHRSLLESLMPSKVTV
DSDKIRPSSSSRNGSTSRRAVLSSSKPSSSGDPSDPNRVGGLAPSSSIRPLSAQRAHHSG
GTEIKSLSWSKMGRSSHDDAIRNFELLSLCADKRKIRN*

Other information
Ka divergence:0.440225KaKs divergence:0.703034
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1350Length 2 (bp):1377Length divergence:0.01
MFE 1 (kcal):-421.24MFE 2 (kcal):-414.84MFE divergence-0.008