Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G032721-GRMZM2G361569
Species:maize
Duplication type:WGD
Function (paralog1):plastid-specific 30S ribosomal protein 3 (LOC100282135), mRNA
Function (paralog2):hypothetical protein LOC100193993

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.500521121356
Log2 mRNA fold difference:2.0324815411978
Log2 TE fold difference:0.46589750992469
Sequences
Protein sequence

MLVLKFIWMEKNIGIALDQLVPGYGSIPLSPYYFWPRKDAWEELRAKLEEKEWISQKQMI
ILLNQATDIINLWQQGGGSLST*

MLPMAVHPTTTPALSPRARVSPHRPPISSLADPSSSPCHRIVSFKSRRLPLRSLHIAAAA
AAGAEEEEAQLGGSVNAVDEEEAENKVVVPERQDPMLVLKFIWMEKNIGIALDQLVPGYG
SIPLSPYYFWPRKDAWEELRAKLEEKEWISQKQMIILLNQATDIINLWQQGGGNLST*

Other information
Ka divergence:1KaKs divergence:0.99262
GC content 1 (%):52GC content 2 (%):61GC content divergence:0.08
Length 1 (bp):249Length 2 (bp):534Length divergence:0.364
MFE 1 (kcal):-77.2MFE 2 (kcal):-203.94MFE divergence0.451