Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G032763-GRMZM2G135367
Species:maize
Duplication type:WGD
Function (paralog1):electron transporter
Function (paralog2):electron transporter

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.50739130107053
Log2 mRNA fold difference:-1.5561407341805
Log2 TE fold difference:2.0483194564642
Sequences
Protein sequence

MSACFLPSAPDLKIEQIPASSSLSPTSARTPPLMWLPWVKTRPSSATSTSNSPSTALVAA
ASPRLSFSSPSLKDLQALLLSDAATPSPPPAAPCSPSSSVRVFHRVRVAASALRALRTLQ
APPSSGGGAAFEADRRVVLYFTSLHVVRSTYEDCRAVRAILRGLRVAVDERDLAMDTRYF
QELAALLPRPVAPRRVTLPQVFVGGRHLGGADEVRRLHEAGELRRVVAGAVAASLATCGR
CGGERYVLCGSCNGSHKRYSAKGGSGFRTCAVCNENGLVRCPDCSPPDV*

MWLPWVKTRPSSATSTSPTSTALVAAAAAASPRLSFSSPSLKDLQALLLSDAATPSPPPA
APCSPSSRVRVFHRVRVAASALRALRTLQAPPPAGATSSEAAERRVVLYFTSLHVVRGTY
EDCRAVRAILRGLRVAVDERDLAMDPRYLPELAALLPRLASPRRATLPQVFVGGRHLGGA
DEVRRLHEAGELRRVVAGAGAASLAACGRCGGEQYVLCGSCDGSHKRYSAKGGGGFRACA
GCNENGLVRCPVCSPPDV*

Other information
Ka divergence:0.121174KaKs divergence:0.413709
GC content 1 (%):72GC content 2 (%):77GC content divergence:0.034
Length 1 (bp):870Length 2 (bp):777Length divergence:-0.056
MFE 1 (kcal):-391.5MFE 2 (kcal):-388.79MFE divergence-0.003