Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033027-GRMZM5G810231
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100383592
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.68603076429446
Log2 mRNA fold difference:1.1374162285749
Log2 TE fold difference:-0.44259233760987
Sequences
Protein sequence

MAAAPPPDPTVLIEDLVEEFLLRIPPDDPASLARAALVSRHWHRVITGPVFRRRFREFHR
SPPLQGYISNIHNSIQFVPISSFRPRHADLDDVIAIHSSPGRVLLCRRPGKGLDVFPGKG
LDVFLSVWDPITDELRDLPALPLPVVPGPCTCNWDAAVICAVGEGCNHIHCGFKVVCVGT
SQRRDFSCVYSPEAGSCWSDLIFAASGEHTNSFETGTCVHAGSSLYFLSRFNHEIVKYDL
LTDRMSTICFRVEPDAQINGMATVLIATEDGRLGVAKTSNSTLGCSTLHLWIRDHERWEE
RRPIELRMLLPDDALRDPQFPPEFFPDKPWLAGFAGTRAGVIFFKTRLGYFVVDLNSGTS
KNIGECLGWGCIIPYVSFCTPAPGAISTDEGPEAGLEG*

MAAAPPPDPTVLIEDLVEEFLLRIPPDDPASLARAALVSRHWHRVITGPVFRRRFREFHR
SPPLQGYISNIHNSIHFVPISSFRPRHADLDDVIAIHSSPGRVLLCRRPGKGLDVFPGKG
LDVFLSVWDPITDELRDLPALPLPVVPGPCTCNWDAAVICAVGEGCNHIHCGFKVVCVGT
SQRRDFSCVYSPEAGSCWSDLIFAASGEHTNSFETGTCVHAGSSLYFLSRFNHEIVKYDL
LTDRMSTICFRVEPDAQINGMATVLIATEDGRLGVAKTSNSTLGCSTLHLWIRDHERWEE
RRPIELRMLLPDDALRDPQFPPEFFPDKPWLAGFAGTGAGVIFFKTRLGYFAVDLNSGRS
KNIGGCLGWGCIIPYVSFCIPGTLAPCFHSVFCSFALAQ*

Other information
Ka divergence:-0.903683KaKs divergence:0.994843
GC content 1 (%):56GC content 2 (%):55GC content divergence:-0.009
Length 1 (bp):1197Length 2 (bp):1200Length divergence:0.001
MFE 1 (kcal):-444.42MFE 2 (kcal):-437.42MFE divergence-0.008