Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033130-GRMZM2G152768
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100382099

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.25238593423036
Log2 mRNA fold difference:-0.4662706381198
Log2 TE fold difference:0.21209319917588
Sequences
Protein sequence

MAGGGGGARGSDRAGAARSPTTTTAIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETA
QKLLNQDPFHEVKRKRDKKKESAGQKSFADSTAQVEQNSQWMKPHTQKMENDQRTPKQGQ
MSGPTREFRVVRDNRFQHGVVENRPELGHKGSANVQMSDRRFDVSLFRAYGTRTNPMKLQ
GTFVESGRNRSPATTSGDQITHQNAMQNSNSDTTQGKRDAQGTTEKHVKPYLKNPQNEQH
FPGSDPAHGSANVRIAGGTVGPAQRHVGVVNSTRQFAARSGSQMHAPSGSYANIQRGSFT
SVGASGRYSAFMSRNIQQNQRPDTMFRGRPTVRSFVAQNTNRYHQGSTSNQKAVHPIKEW
KPKSTKKSPTIDADNSIADATSPSASNCESANTLNVNELPEKISQTNLHEVEHVIIPEHL
RVPEYEQTKLSVQESVQQASEYDSLDAGPDDMDEQARSSQHLSTSTAEISLPPSEDSDRM
SGQVENDDGLGLVQSDTPIGAADGDNTQITSTLTAFSAYSHEDPNMHTNNEAQLYGLVEP
NVHPQVLASSSQPAVWNGAPAIHRDKNTVEAVRSGQKIRNPIPEPELPATRFLFVKFGES
IGYIIGRIFGYFGNTRYLDPNFRNENIMELDCLYPKSSYILKWSNMDEMYYLVLTVPYSH
QGYPSENPEADNAVQVFRMPESNVHSQVLPSTSEALNPQIVSNSPVSISSQQQQHISQQQ
AAAQMYPQMHVQHFPNFMPYRQLYSPVYPMPMPNYSPNVPYPSNGNNYLQMPSGGSHLTA
GSVKYGVSQFKPLPSGNPSGYGNYTHPAGFTMGSPGVIGATVGVDDVNRMKYKDNIYAST
PQVETSDIWIQQAREMPPMQVPSYYNIPGQATPGAFVPNPANASFNATAQSSHVQFPGLY
HPQQPPSIGFSVLCNLMQCDNLVRVLCNWVHLDDSLEQESTT*

MAGVGGGARSSDRAGAARSPTTTTTTTTTAIQSTIQSIKEVVVGHSDADILDTLRESNMD
PNETAQKLLNQDPFHEVKRKRDKKKESAGQKSFADSTGQVDQNPQWMRPHTHRMENDQRR
LPNQGQMSGPSHEFRVVRDNRFQHGVVENRPEPGHKGSADVQMSDRSTVVQSARNLSPAT
TSDGQITHQNAMQNSQSDITQGKRDGQGTTQKHAKPYLKNSQNEQHFPGSDPAHGSATVR
IAGGTVGPTRRHVGVINSSRQFVGRSGSQMHAPGGSSYANIQRGSFTSVGASGRYSAFMS
RNIQQNLRADTTFRGRPTGRSFIAQNVNRYHQGPTTNQKAVHPIKEWKPKLTKKSPTIDA
ENSIADAASPSASNCENANTTDVNGLPEKLSQANLHEVEHVIIPEHLRVPEYEQTKLRFG
SFTPDLDLEQVPDLTPQDTEQPEHVQEPVQQVSEGDSLDDGHDDMDEQARSSQHLSSSTA
EISLSPSEDSDQMSGQVENDDGLGLVQSDTPVGAADGDSTQITSTLTAFSAYGHKDPNIH
TTNEAQLYGLVEPNVHPQALASSSQGYPSENPEADNAVQVFRMPDSNVHSQVLPSTSEAL
NPQIVSNSPVPISSQQQHISQQQAATQMYPQMHVQHFPNFMPYRQLYSPVYPMPMPNYSP
NVPYPSNGNSYLQMPSGGSHLTAGSVKYGVSQYKPVPSGNPSGYGNYTHPAGFTMGSPGV
IGAAVGVDDVNRMKYKDNIYASTPQVETSDIWIQTAREMPPLQVPSYYNIPGQATPGAFV
PNPANASFNATSQSPHAQFPGLYHPQQPPSIVSPHPMVHQQVPSAIGPNVGVGVAAPGPQ
VGAYQQRQIGHMNWRPSF*

Other information
Ka divergence:-0.20604KaKs divergence:-0.351495
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):2829Length 2 (bp):2577Length divergence:-0.047
MFE 1 (kcal):-861.53MFE 2 (kcal):-811.91MFE divergence-0.03